Conserved Protein Domain Family
P21_Cbot

?
TIGR03209: P21_Cbot 
clostridium toxin-associated regulator BotR
Clostridium botulinum neurotoxin production is regulated by a regulatory sigma-70 protein, BotR transcription regulator. Similarly, tetanus toxin production of Clostridium tetani is regulated by TetR which is a very close relative of BotR. Both BotR and TetR are members of the TIGR02937 subfamily of sigma-70 RNA polymerase sigma factors. Functional complementation experiments have been done for botR and tetR in highly transformable strain of Clostridium perfringens host cells to assess functional interchangeability of sigma factors and it has been confirmed that they are interchangeable in vivo.
Statistics
?
PSSM-Id: 132253
View PSSM: TIGR03209
Aligned: 5 rows
Threshold Bit Score: 167.29
Threshold Setting Gi: 6729208
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6729208    18 FNFIEMSLKKYIEKTSKKYNLYYDYyNDILYHLWKELIEINLKNFNSELDLRKYISTSIKRYCINICKKKNRDKKIIYNS 97
gi 2104803    21 FEEIYRNFENFIDMLTRKYDVEKDY-NDIVSHLWIILKKTDLNKFNTEYDLEKYISTSLKRYCIDICNKKNRNERVIYNS 99
gi 1619266    18 FEDIYTNYKNLIDIFIKKYNLSENY-NDILNHFWIILKKADLNKFNTENDLNKYISKCLKRYCLSICMKKNRDKKIIYNS 96
gi 2289035    18 FQEIFKHFEKTINIFTRKYNIYDNY-NDILYHLWYTLKKVDLSNFNTQNDLERYISRTLKRYCLDICNKRKIDKKIIYNS 96
gi 499413370  18 FEVIIIHFKNTVNILIRKYNLESHY-NDILYHLWNILKKIDLNKFNTENDLHKYISRSLKRYCLDICNKKNRDKKIIYNS 96
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 6729208    98 EVTYKKLDAV-NVYSLYCDNFEFLDLISILNYKEKQIIYMKFFECRKDNEIARRLHLSRQSIYK 160
gi 2104803   100 EFVDINLSLI-EHSFSNDLEFEFNDLISILPNSQRKIIYMRFFNNMKEVDIAEELNISRQAVYK 162
gi 1619266    97 EITNINLNLI-QDNCFNDIEFEFKDLISILPNTQKNIIYMKFFKDMKDIQIAKKLKISRQSVYK 159
gi 2289035    97 EIADKKLSLIaNSYSSY-SEFEFNDLISILPDDQKKIIYMKFVEDIKEIDIAKKLNISRQSVYK 159
gi 499413370  97 EITNIKLNLM-ENSCSNYLNFEFNDLISILPENQRKILYMKFFEDMKECDIAKKLHMSRQAVYK 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap