1KMY


Conserved Protein Domain Family
23dbph12diox

?
TIGR03213: 23dbph12diox 
Click on image for an interactive view with Cn3D
2,3-dihydroxybiphenyl 1,2-dioxygenase
Members of this protein family all have activity as 2,3-dihydroxybiphenyl 1,2-dioxygenase, the third enzyme of a pathway for biphenyl degradation. Many of the extradiol ring-cleaving dioxygenases, to which these proteins belong, act on a range of related substrates. Note that some members of this family may be found operons for toluene or naphthalene degradation, where other activities of the same enzyme may be more significant; the trusted cutoff for this model is set relatively high to exclude most such instances. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 132257
View PSSM: TIGR03213
Aligned: 9 rows
Threshold Bit Score: 420.64
Threshold Setting Gi: 42475466
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KMY_A        2 IRSLGYMGFAVSDVAAWRSFLtQKLGLMEAGTTDNGDLF-RIDSRAWRIAVQQGEVDDLAFAGYEVADAAGLAQMADKLK 80
gi 3913216    4 VTGIGYIGIGVSDLPAWEEFA-ETIGFQIRERGEDGTLYlRMDKAHHRVAVHPTGEDDLTYVGWQVADENGFDELERTLR 82
gi 1345621    3 IRSLGYMGFAVSDVAAWRSFLtQKLGLMEAGTTDNGDLF-RIDSRAWRIAVQQGEVDDLAFAGYEVADAAGLAQMADKLK 81
gi 135975     3 IQRLGYLGFEVADVRSWRTFAtTRLGMMEASASETEATF-RIDSRAWRLSVSRGPADDYLFAGFEVDSEQGLQEVKESLQ 81
gi 1352082    3 VQRLGYLGIEVSDVDAWRTYAtMRLGAMEAPAPEGTARF-RLDSRAWRFMVTPGPADDLSVAGYEVDSEGALMQVKTRLE 81
gi 15384206   6 VTELGYIGIGVSDMDAWREYAaNVMGLEVLEEGDKDRFYlRLDYQHHRIVVHNSGSDDLDYAGWRVAGPEEFDQIKRNLE 85
gi 4335675    4 VSELGYLGMSVTDLDAWRAYAaEVAGMEVVDEGESDRIYlRMDLWHHRIALIKGDTDDLAYMGWRLGDPTEFESMVEKLT 83
gi 42475466   4 LRGLGYLRIRTQDVPRWRELLiDGLGMAVGSGPEPDALYaRVDERRARIAVLPGDSDKALAVGWEVRDEFALERVREAVE 83
gi 3059181    6 IKGLGYVKISTNDMARWRTFAfDVLGFAKGSGPDENALYlRLDERAARIVVVEGERDEIVNIGWEVADHAALRRVQEALE 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KMY_A       81 QAGIAVTTGDASLARRRGVTGLITFADPFGLPLEIYYGASEVfEKPFLPGAAVSg-FLTGEQGLG---HFVRCVPDSDKA 156
gi 3913216   83 AAGVPVEMAGEDDAELRGVARLMRFEDPSGIKSEAYYGLVSEpEVPYVSPYAVD--FVTEDQGFG---HIVVMVDDYDET 157
gi 1345621   82 QAGIAVTTGDASLARRRGVTGLITFADPFGLPLEIYYGASEVfEKPFLPGAAVSg-FLTGEQGLG---HFVRCVPDSDKA 157
gi 135975    82 AHGVTVKVEGGELIAKRGVLGLISCTDPFGNRVEIYYGATELfERPFASPTGVSg-FQTGDQGLG---HYVLSVADVDAA 157
gi 1352082   82 AYGVKVTSESSELAAERGVLGLISCVDPAGTRLEIYYGGTEMfEVPFASPTGVKe-FRTDDQGMG---HYVLAVPDVDAA 157
gi 15384206  86 KARVDFRQADAAECDERMVLDLVKFLDPGGNPTEIYHGPRVDyHKPFHAGRRMHgrFSTGDQGLGhigHIILRQENPQKA 165
gi 4335675   84 NAGIAVTVASDAEARERRVLGLAKLTDPGGNPTEIFYGPQVDaHKPFHPGRPMFgkFVTGSEGIG---HCILRQDDVEAA 160
gi 42475466  84 KSGRAVEVLSRKEATYLDAEGAIAFEDPAGTRLEVFYGPVLD-HSPVVTPFAGR--WVTGGLGLG---HVVLPATNFDET 157
gi 3059181   86 KNGTEVEQLSLAEADARRVEEVIAFTDPGGAAIEVFHGAILD-HSPVVTPFGAR--FVTGSQGLG---HVVLPVMDSAAS 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KMY_A      157 LAFYTDVLGFQLSDVIDMKMGp-DVT-VPAYFLHCNERHHTLAIAAFP--LPKRIHHFMLEVASLDDVGFAFDRVDADGL 232
gi 3913216  158 MRFYREVLGLQTSDLVKVGAG--GVQ-TRMAFMRCNPRQHSLAFWAGD--STTRLNHFMLQTQTLDQTGMTLDRCFHGGI 232
gi 1345621  158 LAFYTDVLGFQLSDVIDMKMGp-DVT-VPAYFLHCNERHHTLAIAAFP--LPKRIHHFMLEVASLDDVGFAFDRVDADGL 233
gi 135975   158 LAFYTKALGFQLADVIDWTIGd-GLS-VTLYFLYCNGRHHSFAFAKLP--GSKRLHHFMLQANGMDDVGLAYDKFDAERA 233
gi 1352082  158 LDFYVQGLGFHLSDVIDWQVSp-EVS-VRLHFLHCNGRHHTLAVVGMP--SDKKMHHLMIETTNLDDVGLAYDRCVEDDA 233
gi 15384206 166 YEFYARVLGMRGSVEYHIPIPhiGIT-AKPIFLHSNDRDHSVAFLGGP--AAKRINHLMIEVDNIDDVGYTHDIVRKRQI 242
gi 4335675  161 AAFY-RLLGLRGSVEYQLHLPn-GMV-AMPYFMHCNERQHSVAFGLGP--MEKRINHLMFEYTELDDLGLAHDIVRERQI 235
gi 42475466 158 YEFYTQVLGFLPRGSIRLDEE--GLN--RVRFLGINERHHALALCPAPptEEPGLVHLMTEVDTLDAVGQALDRVNGMDF 233
gi 3059181  160 FDFYTEVLGFYPRGAFRLPAPp-EFGpLRIRFMGVNERHHSLALCPAPhgGAPGLIHIMVEVDTLDAVGQALDRVMKDGF 238
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*.
1KMY_A      233 -ITSTLGRHTNDHMVSFYASTPSGVEVEYGW-SARTVDRSWVVVRHDSPSMWGHKS 286
gi 3913216  233 -PATNLGRHVNDYAVSFYITTPSGFMIEYGW-GVREVVSDYPVDKYRSVSIWGHRN 286
gi 1345621  234 -ITSTLGRHTNDHMVSFYASTPSGVEVEYGW-SARTVDRSWVVVRHDSPSMWGHKS 287
gi 135975   234 -VVMSLGRHTNDHMISFYGATPSGFAVEYGW-GAREVTRHWSVVRYDRISIWGHKF 287
gi 1352082  234 -VILTLGRHTNDHMVSFYGATPSGFAVEFGW-GSRVVEPGWSVVRYDAISIWGHKI 287
gi 15384206 243 pVAVQLGKHSNDQMVSFYSANPSNWLFEYGAlGRR---ATYQS-EYYVSDIWGHEI 294
gi 4335675  236 dVALQLGKHANDLALTFYCANPSGWLWEFGW-GAR---KAPAQQEFYTRDIFGHGN 287
gi 42475466 234 sISSTLGRHTNDKMISFYVRAPGGWDLEFGTeGMLVDERHYTSEEITADAYWGHDQ 289
gi 3059181  239 sVSSTLGRHTNDKMISFYVRAPGGWDIEFGTeGARVDQDSYSSEEITADSYWGHDW 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap