Conserved Protein Domain Family
benzo_boxA

?
TIGR03224: benzo_boxA 
benzoyl-CoA oxygenase/reductase, BoxA protein
Members of this protein family are BoxA, the A component of the BoxAB benzoyl-CoA oxygenase/reductase. This oxygen-requiring enzyme acts in an aerobic pathway of benzoate catabolism via coenzyme A ligation. BoxA is a homodimeric iron-sulphur-flavoprotein and acts as an NADPH-dependent reductase for BoxB. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 132268
View PSSM: TIGR03224
Aligned: 4 rows
Threshold Bit Score: 822.974
Threshold Setting Gi: 94310165
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499801831   8 VIKQHLIDPEICIRCNTCEAICPVQAITHDSRNYVVDAEKCNLCMACISPCPTGSIDNWRTMPRIKAYSLTEQLGWDELP 87
gi 499813278   9 VLRQHLIDPEICIRCNTCEETCPIDAITHDDNNYVVKADVCNGCMACVSPCPTGAIDNWRTVLKADAYSIDEQFSWDELP 88
gi 499556612   9 IAKQHLIDPEICIRCNTCEETCPIDAITHDNLNYVVNFDICNGCLACVPPCPTGAIDSWRNVERAKPYSLEEQFKWDVLP 88
gi 499835261   6 IIKQHLIDPEICIRCNTCEDTCPIDAITHDDRNYVVKADVCNACNACLSPCPTGAIDNWRTMLKGQAYTIEAQLTWDELP 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499801831  88 PELTPEELAAEgvvPGAMPEIEPVApslPAAVSGETafNSAQYGATMPPWSAAHGYTNLYGAKAAekfITATVVGNVRVT 167
gi 499813278  89 AQNTTANAALD---ATAQANGDDET---GETASGIE--VDAARGSTVPPWSAAKPYVNLYTHKAP---TTATVVGNYRLT 157
gi 499556612  89 DTTELDNVDA----PFAVARPDDELpaeVQHITEVA--TAGQGGPALAPWSASHPYVNLYAPTRP---ITATVTGNYRLT 159
gi 499835261  86 EEVPLPEAEIE---AAAAAGQVIEEasrGSKSVAVQevEASRHTSSRAPWSAAHPYVNLHGVREP---VTATVAGNHRLT 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499801831 168 EVGKEYDTHHIVLDFGSMPFPVLEGQSIGILPPGTDEASKPHYARQYSIASPRNGERPGYNNVSLTIKRVLQDHQGNAVR 247
gi 499813278 158 DELADSDIHHIVLDFGTLPFPVLEGQSIGILPPGTTKDGKPHHARQYSLASPRDGERPRYNNVSLTVKRVTRDYQDNATD 237
gi 499556612 160 DADASSDIHHVVLDFGSTPFPVLEGQSIGIIPPGTDDKGRPHLLRMYSVASPRNGERPHYNNLALTVKRVTEDHEGKAAR 239
gi 499835261 160 AEDASSDIHHIVLDFGNHFFPVLEGQAIGIVPPGTDASGKPHYIRMYSVASPRDGERPGYNNLALTVKRVDTDHDGNPVR 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499801831 248 GVGSNYMCDLQIGDKVQVIGPFGTSFLMPNHPRSNIVMICTGTGSAPMRAMTEWRRRLRQSGkfEGGKLMLFFGARTKEE 327
gi 499813278 238 GVCSNYLCDLKKGDKVTVIGPFGSTFLMPNHPDSHLLMICTGTGSAPMRAMTEYRRRRRLKG--ATGKLMLFFGARTKEE 315
gi 499556612 240 GVASNYVCDLKKGDKVQVTGPYGSTYLMPNHPASSIMMICTGTGSAPMRAMTERRRRRIAQN--EGGELVLFFGARAPSE 317
gi 499835261 240 GVASNFLCDLAKGDPVQVVGPFGSTFLMPNHREASVMMICTGTGSAPMRAMTERMRRNMDH---FSGRRLLFFGARNRRE 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499801831 328 LPYFGPLQTLPKDFIDINFAFSRTLEQPKRYVQDAMRERAADLGVLLKDPNTYFYVCGLKSMEEGVVLALRDVAQQAGLS 407
gi 499813278 316 LPYFGPLTNLPKDFIDTNLAFSRTPGQPKRYVQDAMRERAVDIAQLLKSDGTYIYVCGLKGMEDGVLQALQEIAERNGLD 395
gi 499556612 318 LPYFGPLQKLPKDFIDINFAFSRVPGEPKKYVQDSIRERADKVFRMLNDDNCYIYICGLKGMESGVLEAFRDICRANGAD 397
gi 499835261 317 LPYFGPLLKLPKDFLDIHFAFSRDPEVPRRYVQDAIREASAQVAALLADPHGHIYICGLKGMEEGVLDAFAEVCATSGQS 396
                        410
                 ....*....|....*....
gi 499801831 408 WETVGAALKQEGRLHLETY 426
gi 499813278 396 WATLWPRLRREGRLHLETY 414
gi 499556612 398 WEALQPKLLANARFHVETY 416
gi 499835261 397 WQDIEPRLRAEGRLHIETY 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap