Conserved Protein Domain Family
PhnS

?
TIGR03227: PhnS 
2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein
This ABC transporter periplasmic substrate binding protein component is found in a region of the salmonella typhimurium LT2 genome responsible for the catabolism of 2-aminoethylphosphonate via the phnWX pathway (GenProp0238). The protein contains a match to pfam01547 for the "Bacterial extracellular solute-binding protein" domain.
Statistics
?
PSSM-Id: 132271
View PSSM: TIGR03227
Aligned: 2 rows
Threshold Bit Score: 570.512
Threshold Setting Gi: 62179040
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 490299218   1 MTYTNFPRggaWRRFALAAgaaallqgaaAQAQAAAVVL-YTADGLEN----LYRDVLPAFEKQEGVKVNIVTAGSGEVV 75
gi 486183755   1 MKLSRLAL---LSVFALAS----------APSWAESVVTvYSIDGLHDgdnsWYQVQFDAFTKATGITVRYVEGGGGVVV 67
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 490299218  76 NRANVEKGSPKADVIVTLPPFIQQAGQFGLLQPYRSVNYKNVPAiakaEDGSWATFVNNYFSFAINPSVVKSQPKTFADL 155
gi 486183755  68 ERLAKERTNPQADVLVTAPPFIQRAAAEKLLANFNTDAASAIPD----ANNLYSPLVKNYLSFIYNSKLLKTAPASWQDL 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 490299218 156 LHPDYSGKLAYSNPATAGDGMAVIILTSALMG-EDKAFDYLAKLERSVKFHTKGTGYLNVLLSRNEIAVANGDLQMDLDD 234
gi 486183755 144 LDAKFKNKLQYSTPGQAADGMAVMLQAFHSFGsKDAGFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQMNLAQ 223
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 490299218 235 AEHGGlSIKPIFVAAKAGEPpTTFQLPYAIGLVKGGPNQDAGRKLIDYLMSADVQAKVPDM-FGIPGRTDVPLSGKNGEA 313
gi 486183755 224 MERNP-NVKIFWPANDKGER-SALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQTRVSELsWGMPVRSDVTPSDEHYKA 301
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*..
gi 490299218 314 VKRAIAGVKLIPVDWDAVMAKKPVWTERWKKevigdsgkqteVVKPK 360
gi 486183755 302 ATAALEGVQSWQPNWDDVAVSLSADISRWHK-----------VTESE 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap