Conserved Protein Domain Family
benzo_1_2_benA

?
TIGR03229: benzo_1_2_benA 
benzoate 1,2-dioxygenase, large subunit
Benzoate 1,2-dioxygenase (EC 1.14.12.10) belongs to the larger family of aromatic ring-hydroxylating dioxygenases. Members of this family all act on benzoate, but may have additional activities on various benozate analogs. This model describes the large subunit. Between the trusted and noise cutoffs are similar enzymes, likely to act on benzoate but perhaps best identified according to some other activity, such as 2-chlorobenzoate 1,2-dioxygenase (1.14.12.13). [Energy metabolism, Other]
Statistics
?
PSSM-Id: 132273
View PSSM: TIGR03229
Aligned: 5 rows
Threshold Bit Score: 935.035
Threshold Setting Gi: 25028861
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499619787  19 LDQFLVENHETGDYRLHRSAFTDEALFELEMKHIFEGNWIYLAHESQIPNNNDYYTTHMGRQPVFIARNRQGELNAFINA 98
gi 491063864  15 IDELLVDNTETGEFKLHRSVFTDQALFDLEMKYIFEGNWVYLAHESQIPNNNDYYTTYIGRQPILIARNRNGELNAMINA 94
gi 504403909   8 LNAMLEDDREKGIYRCKREMFTDPRLFDLEMKHIFEGNWIYLAHESQIPEKNDFLTLTMGRQPIFIARNKDGELNAFLNA 87
gi 499607772   7 LDSLIQKDKEKGLFRCKREMFTSQELFDLEMKYLFEGNWIYLAHESQVGKINDYYTTKMGRQPVFITRNKDNQLNCFINA 86
gi 493820795  15 LDRALEDRPEEGIVRVNRNIFTDPEIFELEMRHIFEGNWIYLAHESQIPNPGDYFTTYMGRQPIMITRSKDGELNCLINA 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499619787  99 CTHRGAMLCRHKRGNKATYTCPFHGWTFNNSGKLLKVKDPEGAGYPECFNKEGSHDLKKVARFENYRGFLFGSLNDDVLP 178
gi 491063864  95 CSHRGAQLCRHKRGNKTTYTCPFHGWTFNNSGKLLKVKDPSDAGYSDCFNQDGSHDLKKVARFESYKGFLFGSLNPDVPS 174
gi 504403909  88 CSHRGAMLCRHKRGNRSSYTCPFHGWTFNNSGKLLKVKDPSNAGYPDSFNCDGSHDLTKVARFESYRGFLFGSLNADVKP 167
gi 499607772  87 CAHRGATLARFKHGNKGTYTCPFHGWTFNNSGKLLKIKDPEGTGYPATFNCDGSHDLKKIARFESYKGFLFGSLNADVLP 166
gi 493820795  95 CSHRGAMLCRRKTDNRTTLTCPFHGWTFSNDGALLKVKDEKDGAYPENFNKDGSHDLRRVPKFESYRGFLFGSLNPDVVS 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499619787 179 LKDFLGDAARIIDMIADQSPDGLEVLRGSSTYTYEGNWKLQAENGADGYHVSAVHWNYAATTNHRKQQNEReDKIRAMDA 258
gi 491063864 175 LQEFLGETTKIIDMIVGQSDQGLEVLRGVSTYTYEGNWKLTAENGADGYHVSAVHWNYAATTQHRKEKQAG-DTIRAMSA 253
gi 504403909 168 LVEHLGESAKIIDMIVDQSPEGLEVLRGASSYIYEGNWKLTAENGADGYHVSSVHWNYAATQNQRKQREAG-DEIKTMSA 246
gi 499607772 167 LEEYLGESKKIIDMIVDQSADGLEVLRGASTYVYEGNWKLQAENGADGYHVTATHWNYAATQAQRKSRDAG-DDINAMSA 245
gi 493820795 175 LEEHLGDTRTVIDMLVDQSPDGLEVLRGSSTYTYDGNWKLQTENGADGYHVSSTHWNYAATTSRRGTGESA-NETKAMDA 253
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499619787 259 GKWGQQGGGFYAFDHGHMLLWTRWANPEDRPNFARRAEFAERCGEETADWMIQNSRNLCLYPNVYLMDQFGSQIRLLRPL 338
gi 491063864 254 GSWGKHGGGSYGFEHGHMLLWTQWGNPEDRPNFPKAAEYTEKFGAAMSKWMIERSRNLCLYPNVYLMDQFGSQIRVLRPI 333
gi 504403909 247 GAWAKQGGGFYSFDHGHLLLWTRWANPEDRPAYERRDQLAADFGQARADWMIENSRNLCLYPNVYLMDQFSSQIRVARPI 326
gi 499607772 246 GGWAKNGGGSYSFENGHLLLWTRWDNPEDRPLMEQRDRLVGEFGEAKADWMIKNSRNLCLYPNVFLMDQFSSQIRVFRPL 325
gi 493820795 254 GTWGKQGGGYFSYPNGHMLLWMWWGNPEDRPLYDRRDELKEKFGEEKGEFMVGASRNLCLYPNVYIMDQFSSQIRHFRPI 333
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499619787 339 SVDKTEVTIYCIAPKGEPDDARARRIRQYEDFFNVSGMATPDDLEEFRACQQGYNGSALAWNDMCRGSKHWIEGPDEAAQ 418
gi 491063864 334 SVNKTEVTIYCIAPVGEAPEARARRIRQYEDFFNASGMATPDDLEEFRACQAGYAGIELEWNDMCRGSKHWIYGPDDAAN 413
gi 504403909 327 SVNKTEITIYCIAPKGESADARAKRIRQYEDFFNVSGMATPDDLEEFRSCQTGYGG-GTGWNDMSRGAKHWVEGADEAAK 405
gi 499607772 326 APDRTEVTIYCIAPKGESPEARAKRIRQYEDFFNASGMATPDDLEEFRACQEGFNGAYLEWNDMSRGAEHWVEGPDAEAD 405
gi 493820795 334 SVDKTEVTIYCIAPKGESAQARANRIRQYEDFFNATGMATPDDLEEFRSCQKTYLATGFPWNDMTRGLGHQIEGPNEVAK 413
                        410       420       430
                 ....*....|....*....|....*....|....*
gi 499619787 419 RIGLNPVM-SGVRTEDEGLYTVQHRYWLDVMKKAM 452
gi 491063864 414 EIGLKPAI-SGIKTEDEGLYLAQHQYWLKSMKQAI 447
gi 504403909 406 EIELEPLL-SGVRTEDEGLFVLQHKYWQDTMIQAL 439
gi 499607772 406 KIGLKPIL-SGVKTEDEGLYVAQHTYWLEQMHRAH 439
gi 493820795 414 GLGMNEVLsSGARTEDEGLYPVQHHYWHDLMQRAV 448
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap