Conserved Protein Domain Family
lipo_lipase

?
TIGR03230: lipo_lipase 
lipoprotein lipase
Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity.
Statistics
?
PSSM-Id: 132274
View PSSM: TIGR03230
Aligned: 4 rows
Threshold Bit Score: 912.355
Threshold Setting Gi: 108743278
Created: 9-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108743278  60 DYTDIVSKFSLRTADIPDDDMCYIVAGSPDTIEDCEFNPETQTFIVIHGWTVTGMFESWVPKLVSALYEREPSANVIVVD 139
gi 56790258   52 DFTDIESKFSFRTLEEPEDDLCYIVPGQPQSIKDCNFNTETKTFIVIHGWTVTGMFESWVPKLVTALYEREPSANVIVVD 131
gi 126313     33 NFEGIESKFSLRTPAEPDEDVCYLVPGQMDSLAQCNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVD 112
gi 126314     33 DFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVD 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108743278 140 WLTRANQHYPTSAAYTKLVGRDVAKFVTWIQKELHLPWDRIHLLGYSLGAHVAGIAGDLTEHKISRITGLDPAGPTFENA 219
gi 56790258  132 WLSRAQQHYPTSASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAGLLTKHKVNRITGMDPAGPTFEYA 211
gi 126313    113 WLVRAQQHYPVSAAYTKLVGKDVAMFIDWMEEKFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRITGLDPAGPTFEYA 192
gi 126314    113 WLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYA 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108743278 220 DNQNTLSPDDAQFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDIQSTLLGIAlegIKGLQNMDQLVKCSHE 299
gi 56790258  212 DSLSTLSPDDANFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDLQNTMLMVA---TTGLRNMDQIVKCSHE 288
gi 126313    193 DAPIRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGCNLGEALRLIA---EKGFSDVDQLVKCSHE 269
gi 126314    193 EAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIA---ERGLGDVDQLVKCSHE 269
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108743278 300 RSIHLFIDSLLNTEQQSMAYRCNSKEAFNKGLCLSCRKNRCNKLGYNINKVRRTRSTKMYLKTREMMPYKVFHYQVKVHF 379
gi 56790258  289 RSIHLFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRCNKVGYAVNKIRTRRSSKMYMKTREMMPYKVFHYQVKVHF 368
gi 126313    270 RSIHLFIDSLLYEEKPSMAYRCNTKEAFEKGLCLSCRKNRCNNLGYKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHF 349
gi 126314    270 RSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHF 349
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108743278 380 FSKDPLSFTDQPMKISLYGTHGEKEDIPHVLPVMKGNTTLSFLITTDVDIGDLMIVKLRWEKDTIISWSdWWGSSKFHIR 459
gi 56790258  369 FGKTQLSYTDQPMKISLYGIHGEKENIPYIMPTLNTNSTVSFLLTTDADIGELLMVKLLWEKDTLISWP-WWNSDTFHIR 447
gi 126313    350 FGKTNVTKVDQPFLISLYGTLDESENIPFTLPEVSSNKTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWSdWWTPFAFTIQ 429
gi 126314    350 SGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSdWWSSPGFAIQ 429
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*
gi 108743278 460 KLRIKSGETQSKVIFSAKEGEFVYLVRGGEDGVFVKSKEDNLSRK 504
gi 56790258  448 KLRIKSGETQSKIIFSAKESEFSYLSRGGEAAVFVKDKEAQSSRK 492
gi 126313    430 RVRVKSGETQKKVVFCSRDGS-SRLGKGEEAAIFVKCLEQPVSRK 473
gi 126314    430 KIRVKAGETQKKVIFCSREKV-SHLQKGKAPAVFVKCHDKSLNKK 473
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap