Conserved Protein Domain Family
anthran_1_2_B

?
TIGR03231: anthran_1_2_B 
anthranilate 1,2-dioxygenase, small subunit
Anthranilate (2-aminobenzoate) is an intermediate of tryptophan (Trp) biosynthesis and degradation. Members of this family are the small subunit of anthranilate 1,2-dioxygenase, which acts in Trp degradation by converting anthranilate to catechol. Closely related paralogs typically are the benzoate 1,2-dioxygenase small subunit, among the larger set of ring-hydroxylating dioxygenases. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 132275
View PSSM: TIGR03231
Aligned: 3 rows
Threshold Bit Score: 299.895
Threshold Setting Gi: 50085737
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 491067317   9 VSQFLYKKAELCDNYDWDAYIDLYDEDSEYHIPQWIDDHNYVQDPNQGLSYIYYEDRSGLEDRVFRIRTGKAASATPLPR 88
gi 49080798    9 VEQFLYRHAELCDAQDWDGYLAQFDEQCEFHLPQWESEQRYTRDPKRETSLIYYPSRAGLEDRVFRIRTGKAASTVPMPR 88
gi 499371544   9 IEQFFYRKSELCDAQDWDAYLQLFAVDSEFHLPQWDSEHVYTRDPKREMSLIYYANRSGLEDRVFRLRTGKAASTIPMPR 88
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 491067317  89 TQHNIHNVQVKTLEDGLIEAKVSWRTLYNRQGLEGCFYGRATYVLRPTEDSFRIRRQHSVLLNDKIDSVLDFYHV 163
gi 49080798   89 TLHQIGNVRIAEEGDGLLRVRVNWQTLFQRLDQTGSFFGHATYRLKPHGEAWLIARKHIVLLNDRIDSVLDFYHL 163
gi 499371544  89 TLHMVSNLRIAEGDNGLLRVRLNWHTLFYRLATSEEFYGHATYDLKPQGDSWLIQRKHVLLLNDTINSVLDFYHL 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap