3E99


Conserved Protein Domain Family
benzo_1_2_benB

?
TIGR03232: benzo_1_2_benB 
Click on image for an interactive view with Cn3D
benzoate 1,2-dioxygenase, small subunit
Benzoate 1,2-dioxygenase (EC 1.14.12.10) belongs to the larger family of aromatic ring-hydroxylating dioxygenases. Members of this family should all act on benzoate, but several have additional known activities on various benozate analogs. Some members actually may be named more suitably according to such alternate an activity, such as 2-chlorobenzoate 1,2-dioxygenase (1.14.12.13).
Statistics
?
PSSM-Id: 132276
View PSSM: TIGR03232
Aligned: 7 rows
Threshold Bit Score: 289.79
Threshold Setting Gi: 25028862
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3E99_A        10 IQAFLYRESRLLDDKAWDAWLDCYRADAVFWXPSWDDADALVTDPQREISLIYYPNRQGLEDRVFRIKTERSSAT-VPDT 88
gi 499619788   9 VQAFLYREARLLDDEQWDEWLTCYHAEARFWMPCWDDDGQLITDPEREISLIFYPSRQGLEDRIFRIKTERSSAT-IPDT 87
gi 499645541 543 IQAFLYRESRLLDDKAWDAWLDCYRADAVFWMPSWDDADALVTDPQREISLIYYPNRQGLEDRVFRIKTERSSAT-VPDT 621
gi 491063859  15 ISQFLYSEARFLDDEQWDDWLECYAPQASFWMPAWDDNDQLTENPQTEISLIYYPDRQGLEDRVFRIKTERSSAT-MPDT 93
gi 499256509   7 VRDFLYREARYLDDAQWDQWLELYASDASFWMPSWDDDDTLTEDPQSEISLIWYGNRGGLEDRVFRIKTERSSAT-VPDT 85
gi 499607773   8 VCAFLYREARLLDESDWDSWLALYDENCTFWMPAWDDDGNLTEDPQSEISLIWYGRRAGLEDRIFRIRTERSSAT-IPDT 86
gi 499388393  17 IEDFLYYEARLLDDRRFEDWLQCYREDAEFWMPAWDDNGELTEDPQSEISLIFYPNRGGLEDRVFRIRTERSSATsLPEP 96
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
3E99_A        89 RTSHNIANVERESADGDVHTVRFNWHTLSYRYKTVSSYFGXSRYAIDFSGDAPKIVSKYVVLKNDYINQLIDIYHI 164
gi 499619788  88 RTCHNLSNVEIVERDGDKLTVRFNWHTLAHRYQTNYSYFGMSRYVIDFAGAHPQILDKYVVLKNDYINQVIDIYHI 163
gi 499645541 622 RTSHNIANVERESADGDVHTVRFNWHTLSYRYKTVSSYFGMSRYAIDFSGDAPKIVSKYVVLKNDYINQLIDIYHI 697
gi 491063859  94 RTAHNISNIEVESRDGLQITVRFNWNTLSFRYKNSYSYFGMSRYVIDFSGEQPKILSKYVMLKNDYINQVIDIYHI 169
gi 499256509  86 RTSHNISNIEIVEQGEDNCQVRFNWHTLSFRYKTTDSYFGTSFYTLDLRGEQPLIKAKKVVLKNDYVRQVIDIYHI 161
gi 499607773  87 RTSHNITNVEILEQGNGVIKLRFNWHTMSVRYNHTDHFCGTSFYTLDTSGASPIIKDKKIVLKTDYIRHVIDVYHI 162
gi 499388393  97 RTVHNISNVEILEQRDGEVDIRFNWITNYFRYNNTDMYYGNTFLTIDTSGESMKITKKKVVLQNDYIHHVIDIYHV 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap