Conserved Protein Domain Family
dnd_assoc_3

?
TIGR03238: dnd_assoc_3 
DNA phosphorothioation-dependent restriction protein DptF
A DNA sulfur modification (phosphorothioation) system, dnd (degradation during electrophoresis), is sparsely and sporadically distributed among the bacteria. This protein is one member of a three-gene restriction enzyme cassette that depends on DNA phosphorothioation. [DNA metabolism, Restriction/modification]
Statistics
?
PSSM-Id: 132282
View PSSM: TIGR03238
Aligned: 3 rows
Threshold Bit Score: 658.518
Threshold Setting Gi: 52144400
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499648995  30 LDEVKEYLYIKMPIAIdveKKISSFSSNKP--EVLFLCGSSGDGKSEILT---DCKKKFSTRAHFHLDATHSFDPRENAI 104
gi 499719979  38 IEALRSYLYVKTEIET---RFVDALNQRLPigTILFLCGSSGDGKSEILR---RHYDKFSVDNRFYLDATHSFKPDQNAV 111
gi 447210917 217 FSQFKKYMHVERKIQTdleRILVK-NKELNssSLILLCGSVGDGKSHLLAylnENKRELLEGYEIFNDATESFSPNKNAM 295
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499648995 105 QTLDKVFDQF-----ESGTTPLIVGINTGMLGNY-----AEEGSN--DKFKKVIKDYLSNKTVT---EDIHFINFEDYPK 169
gi 499719979 112 EALDQLFDEH-----NASNKPLIVGINIGMMFNF-----QNTGADrhAAIKEAIGRFIKGDRDV---GRYRFLSFEDYPK 178
gi 447210917 296 ETLEEILQGFsdqliNQSNKKVILAINMGVLHNFitldhQEFTYTalNKFVDSSGLFSSSVTTCygeDHFDLISFGDYHS 375
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499648995 170 FFINEIGYTSEFAQKLLQKLTADDDNiiRQIFDKEKQQQTSQASIKLQaNYELLSIPEVQQTIIELLFKARLMRDQFLTA 249
gi 499719979 179 FSLEEGKVGSDFISKLLAKVTASSSE--NPLYAAYLCDEKNHHKLEYQ-NYRILQEESVQKLIVKTLLYVRLKYDQFFSA 255
gi 447210917 376 YELTEEGPQSTFFLTLLNKIFNKEEG--NPFYLAYQEDVNKKVRTMVHeNYEFIQEPYVQKQIVNLIIQTLVKFKLVISA 453
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499648995 250 RALLDFIFMLL-------------------AGPGYLFDNLFSGGDNELANKIIEFDPAHLRTKKIDRFILANDLNLPDQE 310
gi 499719979 256 RAIMDFIHNLI-------------------AGDSILFDNLFSSSSGELSESLSHLDPCLRRTQKIDEFVVQRSLNISDRE 316
gi 447210917 454 RAFLNFVADIIipdklavikglsefevleqAVPSLMFKR---KERSPILKFLHELDPVHRRSSYIDQIIIDLS------T 524
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499648995 311 FAEFK-QFMNNLGVEALEnSFSYLRLFY----------------ILKGGHFSNDYHVKFEQDFNESLIEQYINVYQLHRD 373
gi 499719979 317 FEYFKiEYQARYGAVEMS-PRSWIRAFY----------------LLRYIDLGNNYHQKFSLDFENIIFEDYINIWQLHHS 379
gi 447210917 525 LNEWN-TVLNR--CVTSNkGRGWLNPFIgeekvdgpsfigfaetVIRITYLTNE---DFSQKIEDQTYHKYVK-----KL 593
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499648995 374 FNnsseHKKQIKDFYNNTLRTAIRKYNNRNAPNLDKSHYLISELNG-YQLASELEIKADLKSISSFSPKSSASFIAFIKV 452
gi 499719979 380 LS----DKKKLRGFYNKTLIASLTKFANRLVPKLVGDGLYLAERNG-VTISATVSIGMDSKALEESNSGQIHCFKAALKV 454
gi 447210917 594 FDfnsgNKKEIKVFYEE-IKDALYKW--KGSPQ--KGYIYLNKPSEkFRLAQFLNLKPSIEHLKFSPNNILESFKASISL 668
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499648995 453 QDHP------LTIPVNINLLRLMKRVVDGYRPNKHDKNTVVLLDELIDEITRVANQVTTL--HIIRDNKHFTIkNVDDEE 524
gi 499719979 455 EDKSi-----EPFPITVSFLELTERILAGYRPNRHDKNTVVILEEVVEKITKIASKSKAL--YFHKDGGDWSL-QFEDDE 526
gi 447210917 669 AYHNgdiketILLDIDYQLYCLLTKVCHGYRPNKKDEEDAIKFTEFVEKIMKFGEKKSELliHFPNDSRFYKLtRDDFDT 748

                 ....*.
gi 499648995 525 FEVSGL 530
gi 499719979 527 FVAETY 532
gi 447210917 749 FVFERE 754
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap