1DXE


Conserved Protein Domain Family
GarL

?
TIGR03239: GarL 
Click on image for an interactive view with Cn3D
2-dehydro-3-deoxyglucarate aldolase
In E. coli this enzyme (GarL) 2-dehydro-3-deoxyglucarate aldolase acts in the catabolism of several sugars including D-galactarate, D-glucarate and L-idarate. In fact, 5-dehydro-4-deoxy-D-glucarate aldolase is a synonym for this enzyme as it is unclear in the literature whether the enzyme acts on only one of these or, as seems likely, has no preference. (Despite the apparent large difference in substrate stucture indicated by their names, 2-DH-3DO- and 5-DH-4DO-glucarate differ only by the chirality of most central hydroxyl-bearing carbon and is alternately named 2-DH-3DO-galactarate.) The reported product of D-galactarate dehydratase (4.2.1.42) is the 5DH-4DO-glucarate isomer and this enzyme is found proximal to the aldolase in many genomes (GenProp0714) where no epimerase is known. Similarly, the product of D-glucarate dehydratase (4.2.1.40) is again the 5-DH-4DO isomer, so the provenance of the 2-DH-3DO-glucarate isomer for which this enzyme is named is unclear.
Statistics
?
PSSM-Id: 132283
View PSSM: TIGR03239
Aligned: 6 rows
Threshold Bit Score: 432.336
Threshold Setting Gi: 33600985
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1DXE_A         8 NKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALKGSASAPVVRVPTNEPVIIKRL 87
gi 499407610   8 NRFRQDLQQGKTLIGCWCALGNPISTEVLGLAGFDWLVLDGEHAPNDIVTFIPQLMALKGSHSAPVVRPPCNEPIIIKRL 87
gi 499513230   8 NQFRQKLLKGETLIGCWCALGNPITAEVLGLAGFDWLLFDGEHAPNDVLSFIPQLMAVKDSASMPIVRVPKNEPVIIKRV 87
gi 486204732   8 NKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALKGSASAPVVRVPTNEPVIIKRL 87
gi 499616931  18 NRFRADILARKRLIGLWSSLGQPVTSEIIGLAGFDWLLLDGEHSPNDVLTLAPQLMALKDSVSAPVVRPPWNDPVMIKRL 97
gi 489909496  10 NRFRQRILAREQLIGYWLSLASHITAEVAGMADFDWLLLDAEHSPNDVPLLLQQLQALQGSASAAVGRPSWNDPVEIKRM 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1DXE_A        88 LDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGVSVSHRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAAT 167
gi 499407610  88 LDIGFNNFLIPFVETAEEAARAVASTRYPPAGIRGVSVAHRSNSYGTEPDYFAKINDNITVVVQIESQDGLDNLDAIIAV 167
gi 499513230  88 LDIGFYNVLVPYVESKEEAEEAVSATRYPPEGIRGVSVSHRNNGYATIPDYFKVINDNIGVIVQIESQKGVDNVDEIAAV 167
gi 486204732  88 LDIGFYNFLIPFVETKEEAEQAVASTRYPPEGIRGVSVSHRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAAT 167
gi 499616931  98 LDIGFYNFLIPFVESAEEARRAVRATRYPPDGIRGVSGVQRQNRFGTLPDFFKTINDNICVLVQIESRKGVEAVAEICAE 177
gi 489909496  90 LDIGFYNLLIPFIESADDARRAVAATRYPPQGMRGVSVAQRSNRYGTVTDYLRTINDNICVLLQIESRPGVEAVDEIAAV 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1DXE_A       168 EGVDGIFVGPSDLAAALGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLGVFRSAT 247
gi 499407610 168 DGVDGVFVGPSDLSAALGYLGQPNHPDVQKAIRHIFDRAAAHNKPCGILAPVEADARRYLEWGASFVAVGSDLGVFRSAT 247
gi 499513230 168 NGVDCLFVGPGDLSAALGYLGQPNHPEVQKVIQHIFATAKKHGKPCGILAPVEADARRYLEWGATFVAVGSDLGVFRGAT 247
gi 486204732 168 EGVDGIFVGPSDLAAALGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLGVFRSAT 247
gi 499616931 178 PGVDGIFIGPNDLAAAYGHLGNPNHPDVQAAVRQICDAANHAGKAIGTLTPVEADARRYLDMGAHFVAVGLDHVLLRDAA 257
gi 489909496 170 DGVDGVFIGPSDLAAALGHLGNPGHPEVQEAIRHLHGRVAAQGKAVGILAPVQADARRYLDMGAHFVAVGSDLGVFKQAT 249

                 ....*....
1DXE_A       248 QKLADTFKK 256
gi 499407610 248 QALSDKYKK 256
gi 499513230 248 KALSEKFKG 256
gi 486204732 248 QKLADTFKK 256
gi 499616931 258 RALRERFAS 266
gi 489909496 250 FALRAAFPA 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap