1YNH


Conserved Protein Domain Family
arg_catab_astB

?
TIGR03241: arg_catab_astB 
Click on image for an interactive view with Cn3D
succinylarginine dihydrolase
Members of this family are succinylarginine dihydrolase (EC 3.5.3.23), the second of five enzymes in the arginine succinyltransferase (AST) pathway. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 132285
View PSSM: TIGR03241
Aligned: 9 rows
Threshold Bit Score: 833.639
Threshold Setting Gi: 53719992
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YNH_A        14 AWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAAKQGLLKMKALADAGFPQAVIPPHERPFIPVLRQLGFSGSD 93
gi 499447588   3 AYEVNFDGLVGPTHNYSGLSFGNVASTSNVSAASNPKLAAKQGLQKMKALYDLGFKQGVLAPQERPDVASLRRLGFGGSD 82
gi 491064233   3 GYEINFDGLVGPTHHYAGLSFGNEASTKNRNHLSNPKLAAKQGLLKMKALADMGMKQGVLAPQERPHVPSLRKLGFGGDD 82
gi 499715121   4 AFEVNFDGLVGPTHNYSGLSYGNVASETNIRDVSNPKEAAKQGLRKMKALHDMGFKQGVLLPQERPDIATLRRLGFTGSD 83
gi 21959200   12 GYEVNFDGLVGLTHHYAGLSFGNEASTTHQNRTSNPRLAAKQGLLKMKALADLGYKQGVLPPQERPAIGVLRKLGFSGSD 91
gi 446917769   3 AWEVNFDGLVGLTHHYAGLSFGNKASTRHRFQVSNPRLAAKQGLLKMKTLADAGFPQAVIPPHERPFIPVLRQLGFSGSD 82
gi 499459859   3 GFEANFDGLVGMTHHYAGLSVGNKASINNKDSVSNPRKAALQGLMKMKALADEGFIQGVLPPQQRPHIPALRNLGFVGSD 82
gi 490297156   3 AKEANFDGLVGPTHNYAGLSFGNVASLSNEKSDANPKAAAKQGLRKMKQLADLGFAQGVLPPQERPSLRLLRELGFSGKD 82
gi 499257634   3 SYEVNFDGLVGPTHNYGGLSYGNVASQSNSQQASNPREAARQGLAKMKALADMGFKQGVLAPQERPDVAALRRLGFSGSD 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YNH_A        94 EQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSADTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVH 173
gi 499447588  83 AEVIARAAKEAPTILAAATSASCMWTANAATVSPSADTADGRVHFTPANLNNKFHRSIEHPTTRRVLRAMFADETRFAVH 162
gi 491064233  83 HAVITQAMRTSPELLSALSSASCMWTANAATVSPSADSADGRVHFTAANLNNKFHRSIEHETTSQILAAIFRDERYFAHH 162
gi 499715121  84 REVLLQAAHQAPVFLGAVASASCMWTANAATVSPSADTTDGRVHFTAANLNAKFHRSIEHPTTTRILQGIFNNDQYFAHH 163
gi 21959200   92 EQVLSDVARNAPRLLSAVSSASSMWTANAATVSPSADSADGRVHFTVANLHNKFHRAIEAETTAVLLPAVFNNHRHFVHH 171
gi 446917769  83 EQVLEKVVRQAPHWLSSVSSASPMWVANAATIAPSADTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVH 162
gi 499459859  83 EQILHKAAKYSPVLLSKLSSASSMWTANAATVSPSADSADQRVHFTVANLNNKLHRSLEIATTTAALKATFADQNYFVHH 162
gi 490297156  83 ADVIAKAARQAPELLAAASSASAMWTANAATVSPSADTSDARVHFTPANLCSKLHRAIEHESTRRTLAAIFADEARFAVH 162
gi 499257634  83 AEVIQRAAREAMPLLVASCSASSMWVANAATVSPSADTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFNDEKYFAHH 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YNH_A       174 SALPQVALLGDEGAANHNRLGGHYGEPGMQLFVYGREE--GNDTRPSRYPARQTREASEAVARLNQVNPQQVIFAQQNPD 251
gi 499447588 163 EALPAQMHFGDEGAANHTRFCADYGQPGVEFFVFGAAAfdMRYPKPAKFPARQTLEASQAVARLHGLSEAGVVYAQQDPD 242
gi 491064233 163 LALPPVALFGDEGAANHNRLGGPYDSAAVQVFVYGQQFl-GGQVAPKRYPARQSLEACQAVARLHQLDSNRTVFVQQNPD 241
gi 499715121 164 KALPPTSQFGDEGAANHTRFCKNYEDKGVELFVYGRVAfdENAPRPMKYPARQTLEACQAVARLHGLADSSVVYAQQNPA 243
gi 21959200  172 DALPSVTLLGDEGAANHNRLGGEYDSPAIQMFVYGRQGm-ESGAVPGRYPARQTREASQAVARLHQLDPKRTVFVQQNPA 250
gi 446917769 163 SALPQVALLGDEGAANHNRLGGHYGEPGMQLFVYGREE--GNDTRPSRYPARQTREASEAVARLNQVNPQQVIFAQQNPD 240
gi 499459859 163 QALPQHEDFGDEGAANHNRLGGDYDSPGVQVFVYGRSVf-RGGPVPKRYPARQTLEASEAIARLHRLNPAQTVFVQQNPV 241
gi 490297156 163 DALPGTPALGDEGAANHTRFCAEYGAPGVEFFVYGRAEy-RRGPEPTRFPARQTFEASRAVAHRHGLREEATIYAQQRPD 241
gi 499257634 163 AALPAVAQFGDEGAANHTRFCRAYGEAGVEFFVYGRSAfdSRYPAPQKYPARQTLEASQAVARLHGLSDDGVVYAQQNPA 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YNH_A       252 VIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARVNG----FMAIEVPATQVSVSDTVSTYLFNSQLLSRDDGS 327
gi 499447588 243 TIDAGVFHNDVISVGNGEVLFHHQQAFLNQADVLDEIARKLEArggrFTAIEVPRAEVTVEEAVKSYLFNSQLLSKPGGK 322
gi 491064233 242 VIDEGVFHNDVIAVSNQQVLFHHQKAFFNQAQALNEIREKMALleqdLIAIEVPDQRVSVGDAVSTYLFNSQLITRPDGG 321
gi 499715121 244 VIDQGVFHNDVIAVGNRNVLFYHEQAFLNTSQMLTELEGKLQGc--lLKAVKVSDSEVSVADAVSSYLFNSQLLSLNDDD 321
gi 21959200  251 VIDQGVFHNDVIAVSNRNVLFHHELAFLSSTQVMDDIRCKMAGleqqLVNIEVPEAEVSVADAVSTYLFNSQLLHKANGK 330
gi 446917769 241 VIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARVNG----FMAIEVPATQVSVSDAVSTYLFNSQLLSRDDGS 316
gi 499459859 242 AIDSGVFHNDVIAVSNRNVLFHHQYAYLNQSQVLTEIRQKMAVlgqnFVSIEVPAEQISIKDAVDSYLFNSQLLSKIDGK 321
gi 490297156 242 VIDAGVFHNDVIAVGNRDTLFCHEHAFVDRQAVYDALAASLGAlgaqLNVIEVPDRAVSVADAVGSYLFNSQLLAREDGT 321
gi 499257634 243 VIDQGVFHNDVISVGNGEVLFYHEDAFLETDAVLGQLRAKLASkggnFQAICVPRAAVAVEDAVRSYLFNSQLLSREDGS 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YNH_A       328 MMLVLPQECREHAGVWGYLNELLAA-DNPISELKVFDLRESMANGGGPACLRLRVVLTEEERRAVNPAVMMNDTLFNALN 406
gi 499447588 323 MLIVVPEECRNSERVWSYLQKLAAS-GGPIDEVRVFDLKQSMQNGGGPACLRLRVALNQAELAAVNPKVLMSDALFASLN 401
gi 491064233 322 MTIVVPEESRQNLAVWSYLNDMIQM-GTPVDQIKVFDLRESMRNGGGPACLRLRVAVNDAEFNAINHNVLMNDALFARLN 400
gi 499715121 322 MMLVVPHECRDNPNVKAYLDDLVTR-GGPIKRVEVFDLKQSMKNGGGPACLRLRVALTEAELAAVHPHVMMSDGLFDTLN 400
gi 21959200  331 MLLVIPQESQDNPSVWRYLSELVSG-DGPIDELRVFDLRESMRNGGGPACLRLRVVLNDAELQAVNSRVMLTPALFVTLN 409
gi 446917769 317 MMLVLPQECREHAGVWGYLNELLAA-DNPISELKVFDLRESMANGGGPACLRLRVVLTQEERRAVNPAVMMNDTLFNALN 395
gi 499459859 322 MVLVVPEECRQHSAVWDYLQSLSAQtSAPINEVRVFDLRESMRNGGGPACLRLRVVLNDAEFRAVNPATLMNTQLYQRLT 401
gi 490297156 322 QMLVVPQECRENANVAAYLDALVAG-NGPIRDVRVFDLRESMKNGGGPACLRLRVVLNDAERAAVKPNVWIGDALFASLD 400
gi 499257634 323 MLLVVPEECRNNERVWAYLGQLTSQ-GGPVKEVKVFDLKQSMQNGGGPACLRLRVALKEAELAAVNQGVIMTATLYDTLL 401
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*
1YNH_A       407 DWVDRYYRDRLTAADLADPQLLREGREALDVLSQLLNLGSVYPFQ 451
gi 499447588 402 GWVDRHYRDRLAPEDLADPQLLIECRGALDELTGILGLGSVYPFQ 446
gi 491064233 401 TWVDRRYRDQLSHQDLADPALLIESRSALDELTQILNLGSVYHFQ 445
gi 499715121 401 AWVDKHYRDRISQQDLADPQLLTECRTALDELTQLLQLGSLYPFQ 445
gi 21959200  410 NWVDQHYRDHLQFKDLADPHLLQEGRQALDELTRILNLGPVYPFQ 454
gi 446917769 396 DWVDRYYRDRLTAADLADPQLLREGREALDVLSQLLNLGSVYPFQ 440
gi 499459859 402 KWIEHHYRDELCASDLADPQLLCEVYTALDELTQILNLGSIYEFQ 446
gi 490297156 401 AWIDKHYRDRLSPVDLADPALLDESRTALDELTQILGLGSLYDFQ 445
gi 499257634 402 QWVDRHYRDRLGEADLADPQLLVECRTALDELTQILKLGSVYPFQ 446
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap