Conserved Protein Domain Family
KdgD

?
TIGR03249: KdgD 
5-dehydro-4-deoxyglucarate dehydratase
5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Statistics
?
PSSM-Id: 132293
View PSSM: TIGR03249
Aligned: 7 rows
Threshold Bit Score: 498.466
Threshold Setting Gi: 54025474
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499379660   1 MNRKAPTGILGFPVTPFDNQGNIDELALSQNIKYLLDSGLEAIFVACGAGEYHSLENGEYESIIEIATSTVKGQVPVYTG 80
gi 499401145   9 MAQTIGSGLLSFPVTPFKADYSFDEATYRANMDWLCGYDVAGLFAAGGTGEFFSLTPTEVPQIVKIAVEETKGRVPVLAG 88
gi 496688744  32 QLRKAPEGILGFPVAPFNREGKLEEEALYENIRFLLDEGLEAVFIACGSGEFQSLSTKEYEQMVEIAVSAADGKVPVYTG 111
gi 499564547   1 MQTNKLTGILGFPVSPFDKNGALDENALHRNITFLIEEGLEAIFVACGAGEFHAISKAEYGAILDVAVDATQKRVPLYTG 80
gi 499744591   7 LKKAVGSGLLSFPVTHFDDQLKFDEAKYRRHVEWLAGYDAAALFAAGGTGEFFSLNPAEIPQVVRAA-KVSAGNTPIISG 85
gi 499866147   7 LKQIISHGLLSFPLTDFDADGSFRPSTYAERLEWLAPYGASALFAAGGTGEFFSLTQREYSDVIRVATETCKGKVPILAG 86
gi 499523397   9 IAARLGSGLLSFPVTHLRADGSFDEAAYREHIAWLGGHDAAGLFAAGGTGEFFSLTPAEVEQVVTAAVREAPEGLPVIAP 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499379660  81 VGGNLSDAVHKAKLSEKHGVDGYLIMPAYLINGEQEGIYQYVHSIATSTDLNAIVYQRDNVVMNLDTIEKLVE-IPQIVG 159
gi 499401145  89 TGYGTAIAREIAVGAEKAGADGLLLLPPYLTHSEQDGLAAHVEAVCAAVKIGVIVYNRDNAILQPDTLARLAErCPNLVG 168
gi 496688744 112 VGGNLSTALEWARISEEKGADGYLILPPYLIHGEQEGLYQYTKTIIESTDLNAIIYQRDNAVLTLEQIQRLTD-LEQLVG 190
gi 499564547  81 VGGNIQDALSFARLSEEKGADGYLILPPYLINGEQNGLHAYLSAIIESTSLHAIVYQRDNAVLEGDTLESLLV-YPQLVG 159
gi 499744591  86 TGYGTSLAIEIAQAAEKAGADGLLLLPPYLMFAEQAGLIAHVKAVCQSVGIGVIVYNRDNAVLTAESIARLAEeCPNLIG 165
gi 499866147  87 AGGATRVAIEYAQEAERLGASGVLLMPHYLTEASQEGIADHVEQVCRALKIGVVVYNRANSKLNADMLERLADrCPNLIG 166
gi 499523397  89 AGYGTATAIEMARAAERAGAHGILLLPPYLTEAGQRGLVEHVRQVCAATDLGVIVYSRANAAYSAPAVAELADrCPNLIG 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499379660 160 FKDGHGSMEHIIEFTQSIGNKIGWLNGMPMAEVTMPAYIPLGFDSYSSAISNYIPHISRKFYDALLEGDETTVNEIYQEV 239
gi 499401145 169 YKDGIGDIELMTRVYTKLGDRLTYIGGLPTAETFALPYLDMGVTTYSSAVFNFVPEFATNFYAAVRKRDHATIHAGLKDF 248
gi 496688744 191 LKDGIGDMALNISLSYTIGDRLGWLNGMPMAEVTMPAYAPIGFTSYSSAISNYIPHISRMFYEALLNGNDRLVKEIYEQV 270
gi 499564547 160 LKDGIGNMEQNIEFTQRFGERLLWLNGMPMAELTMPAYWPIGFHSYSSAISNYIPHISRCFFEALKRGDHEAVRTLYKDV 239
gi 499744591 166 FKDGVGDVDKVIEITTLLGDRLVYVGGMPTHEVYAQAYFAAGVTTYSSAVFNFVPALAQRFYGALRTGNQATVDEILKSF 245
gi 499866147 167 FKDGVGEIESMVTIRRRLGDRFAYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMAFYEAIAKDDHATVGRLIDEF 246
gi 499523397 169 FKDGIGNIEQMTRIYAEVGDRLFYVGGLPTAEMFALPYLALGVTTYSSAIFNFVPQFALDFYRAVRRNDAPFVLNALAEF 248
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 499379660 240 ILPINRIRRQGKGYAISLIKAGMEIVGLPInsNNVRPPVTPVKKEHYEQLEEILKKAL 297
gi 499401145 249 ILPLIAIRNRKKGYAVSIIKAGMKVIGRDS--GPVRPPLTDLTEQEIAELTALVKKLP 304
gi 496688744 271 IIPINEIRKLRKGYAVSLIKAGMEIMGLHVk-NTARPPIVPVEKEHCRQLENILKNAM 327
gi 499564547 240 LLPINVIRRQKKGYAVSLIKAGMEIVGLPVq-EHVRAPLVPVEKSHYKQLAQILENAH 296
gi 499744591 246 FFPFVALRNRKKGYAVSIIKAGLRVLGQNP--GPVRPPLTDLTQEELALLEKIVQANG 301
gi 499866147 247 FLPYLKIRNRRAGYAVSIVKAGAKLVGHDA--GPVRAPLVDLTDEEAAELDVLIKKMG 302
gi 499523397 249 VIPYCELRNREPGYAVSIIKAGMTVIGRPA--GPVRSPLTDLDDAELAELADLVKKVS 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap