Conserved Protein Domain Family
TIGR03252

?
TIGR03252: TIGR03252 
uncharacterized HhH-GPD family protein
This model describes a small, well-conserved bacterial protein family. Its sequence largely consists of a domain, HhH-GPD, found in a variety of related base excision DNA repair enzymes (see pfam00730). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 132296
View PSSM: TIGR03252
Aligned: 5 rows
Threshold Bit Score: 306.351
Threshold Setting Gi: 86741220
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 490072741   4 TLHLAQDPEADELLGRSPLAALVGMLLDQQVPMEWAFKGPSTIARRMGAedLDAHDIAAYDPESFAALLSDKPAVHRYPG 83
gi 489501163   3 NLQLVQEPAADALLNANPFALLVGMLLDQQVPMETAFAGPKKIADRMGS--FDAGDIADYDPDKFVALCSERPAIHRFPG 80
gi 500009402   2 ELHITGDPAADKLLSDDAFALLTGMLLDQQVTMESAFAGPEKIRTRIGS--MDPAAIAGYNPQDFVEMFKERPAVHRFPG 79
gi 499520168   4 TLCLAQEPEADKLLSEDPFALLTGMLLDQQYPLEHAFRGPRKIAERMDG--FDIRRIAEADPQEFEELCATPPAIHRYGR 81
gi 499756199  34 GLHLSQIAEADELLTSDPLALLIGMVLDQQIPLERAFAAPHELTRRLGQp-LDAEELAKYDPDALGAIFSQVPALHRFPG 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 490072741  84 SMAGRVQQLCRYLVETYDGDAEAVWR-GVSTGKELLKRLQELPGFGKQKAQIFLALLGKQLGVRPEGWREAAGAYGEADS 162
gi 489501163  81 SMAKRIQALAQIIVDRYDGDAAALWTaGEPDGNELLRRLKGLPGFGEQKARIFLALLGKQYGVTPKGWQVAAGEFGQPGT 160
gi 500009402  80 SMAGRVQALAETVHQDWNGDATAIWTqGDPDGPEVLRRLKALPGFGEQKAKIFLALLGKQCGLQAEGWREAAGHYGQQDS 159
gi 499520168  82 SMARRTQDLARYVLEHYDGDTTRIWSeGDPDGATVLRRLEDLPGYGKQKARIFLALLGKQLGVRPKGWEKAAGDYAEPNS 161
gi 499756199 113 SMAKRVQAMCQLIVDTYDGDAARVWT-TAADGKELLRRVAALPGFGQQKAKIFVALLGKQLGVTPPGWREASAPFGDEGT 191
                        170
                 ....*....|....*....
gi 490072741 163 FRSVADIRGPESLTKVRAH 181
gi 489501163 161 YLSVADIVDAGSLGQVRSH 179
gi 500009402 160 YLSVADIVDPESLTKVRas 178
gi 499520168 162 RRSAADITDGQSLLEVRAF 180
gi 499756199 192 FRSIADITDVATRDQVREY 210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap