Conserved Protein Domain Family
PhnV

?
TIGR03255: PhnV 
2-aminoethylphosphonate ABC transport system, membrane component PhnV
This membrane component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Statistics
?
PSSM-Id: 132299
View PSSM: TIGR03255
Aligned: 2 rows
Threshold Bit Score: 297.292
Threshold Setting Gi: 126443677
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500178263  17 LRWTDAasrvaSRALVA-LAAAaCCWLFVLPVVVVALSSVAGHWSGtILPAGYSLRWF-ERLGRPEFDALAASLEIGLGV 94
gi 446832535   2 LIWSPK-----GRAAAGvVASVlFIVFFFLPLAVILMSSLSQQWNG-ILPSGFTLNHFvNALHGAAWDALLASLTIGFCA 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500178263  95 AALGTA--LGVALALALEGRTRRgvgALVDALVMLPNGVPSVVLGLAVLIAYHAKPVDLSSSPAIVVFVQLALVLPFCYR 172
gi 446832535  76 SLFALLcgVWAALALRQYGVKTQ---KWLSMVFYLPSAIPSVSVGLGILVAFSQGPLQMNGTLWIVLTAHFVLISAFTFS 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500178263 173 CAAAALRPELTVLREAAASLGAPPAMVLRRVLLPQLVPAIRASLALGFALSLGELGATLTVYPPGFATVPIVVIGAVERG 252
gi 446832535 153 NVSTGLARISADIENVASSLGASPWYRLRHVTLPLLMPWMMSALALSLSLSMGELGATMMIYPPGWTTLPVAIFSLTDRG 232
                        250       260       270
                 ....*....|....*....|....*....|..
gi 500178263 253 YYLPASALSLLLLGASLVALIAIAARAPRPPR 284
gi 446832535 233 NIADGAALTIVLVAITLLLMMKLERIAKRLGQ 264
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap