1E6Y


Conserved Protein Domain Family
met_CoM_red_bet

?
TIGR03257: met_CoM_red_bet 
Click on image for an interactive view with Cn3D
methyl-coenzyme M reductase, beta subunit
Members of this protein family are the beta subunit of methyl coenzyme M reductase, also called coenzyme-B sulfoethylthiotransferase (EC 2.8.4.1). This enzyme, with alpha, beta, and gamma subunits, catalyzes the last step in methanogenesis. Several methanogens have encode two such enzymes, designated I and II; this model does not separate the isozymes. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132301
View PSSM: TIGR03257
Aligned: 4 rows
Threshold Bit Score: 752.116
Threshold Setting Gi: 126864
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E6Y_B      1 SDTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMGGKGRQILGRGLNYDIVGNADA 80
gi 126864   5 EDKICLFDAKGNQVAEDVPLEAISPLNNPTIMGMVKNIKRTVAVNLAGIEESLAKGKIGGKGCQVPGTNIELDVIGDAEA 84
gi 126860   5 EDKVDLYDDRGNLVEEQVPIEALSPLRNTAIKKIIHDIKRTVAVNLEGIENALRSAKVGGSGCHIPGRELDVDVIDNAEA 84
gi 126859   2 SDTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMGGKGRQILGRGLNYDIVGNADA 81
                      90       100       110       120       130       140       150       160
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E6Y_B     81 IAENVKKLVQVDEGDDTNVIKVKGGKSLLIQSPKSRIIAGADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKSAVWGSY 160
gi 126864  85 IADKVKSILQVSAGDDTEVKLINGGKQMAEQVPSKRLDVAAEYSVSMLSTGMALKEALITNFNIDMFDGSTVHSAIMGQY 164
gi 126860  85 IAEKAKEMIQVEEGDDTVVELLHDGKRALVKVPSSRLESAAEYSVAPLVTASAFIQSIIDVCDISIYDANMVKAAVLGRY 164
gi 126859  82 IAENVKKLVQVDEGDDTNVIKVKGGKSLLIQSPKSRIIAGADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKSAVWGSY 161
                     170       180       190       200       210       220       230       240
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E6Y_B    161 PQTMDLMGGQVQGILSIPQNNEGLGFSLRNIMANHVAAISNRNAMNASALSSIYEQSGIFEMGGAVGMFERHQLLGLAYQ 240
gi 126864 165 PQDMDYAGGNIASLLGAPSKLEGLGYALRNIPVNHAVATTKKSLMNAIAFSSILEQTAMFEMGDAVGSFERQHLLGLAYQ 244
gi 126860 165 PQSVEYVGGNIATMLDIPQKLEGPGYALRNILVNHIVAATLKNTLQAVALSSILEHTAMFEMGDAVGKFERLHLLGLAYQ 244
gi 126859 162 PQTMDLMGGQVQGILSIPQNNEGLGFSLRNIMANHVAAISNRNAMNASALSSIYEQSGIFEMGGAVGMFERHQLLGLAYQ 241
                     250       260       270       280       290       300       310       320
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E6Y_B    241 GLNANNLLYDIVKENGKdGTIGTVIESVVRRAIEAGIISVDKTAPSGYNFYKANDVPKWNACAAVGTLAATLVNCGAGRA 320
gi 126864 245 GLNADNLVVELVKANAT-GTVGSVVNSIVEKAIADGVIVVDKTLGSGFNMYKPADVNKWNAYAAAGLVAAVMVSCGAARA 323
gi 126860 245 GLNADNLLYDLVKANGKdGTVGSVVEDVVERAKEDGVIKV-EKELNGYKVYGTDDLALWNAYAAAGLVAATIVNQGAARA 323
gi 126859 242 GLNANNLLYDIVKENGKdGTIGTVIESVVRRAIEAGIISVDKTAPSGYNFYKANDVPKWNACAAVGTLAATLVNCGAGRA 321
                     330       340       350       360       370       380       390       400
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E6Y_B    321 AQNVSSTLLYFNDILEKETGLPGCDYGKVEGTAVGFSFFSHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVCAAVALDAGT 400
gi 126864 324 AQNVASTILYYNDILEYETGLPGVDYGRSMGTAVGFSFFSHSIYGGGGPGIFNGNHVVTRHSKGFAIPPVCAAMCMDAGT 403
gi 126860 324 AQGVSSTILYDNDIIEFERGLPGVDFGRAEGTAVGFSFFSHSIYGGGGPGIFNGNHIVTRHSKGFAIPCVAAAMALDAGT 403
gi 126859 322 AQNVSSTLLYFNDILEKETGLPGCDYGKVEGTAVGFSFFSHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVCAAVALDAGT 401
                     410       420       430
              ....*....|....*....|....*....|...
1E6Y_B    401 QMFSIESTSGLIGDVFGAIPEFREPIKAVAGVL 433
gi 126864 404 QMFSPEKTSALVGTVYSAFDEFREPLKYVIEGA 436
gi 126860 404 QMFSPELTSGLIKDVFSKVDEFREPLKYVVELQ 436
gi 126859 402 QMFSIESTSGLIGDVFGAIPEFREPIKAVAGVL 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap