Conserved Protein Domain Family
PhnT

?
TIGR03258: PhnT 
2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT
This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Statistics
?
PSSM-Id: 132302
View PSSM: TIGR03258
Aligned: 2 rows
Threshold Bit Score: 584.65
Threshold Setting Gi: 53721380
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 446851545  14 QGTSGIVLDSLRVAYHGNVVLKPLSLTIEPGEVLALIGPSGSGKTTVLRAVAGFVQPAG--GRILIGDTDVTHLPPYKRG 91
gi 490686766  24 GACGGVRIEHLSVRYGARTVLDDLSLEIGAGELLAVLGKSGCGKTTLLRFIAGFVKADGltGTLAVAGRDLTHAPPHKRN 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 446851545  92 LAMVVQNYALFPHLKVEDNVAFGLRAQKQPKALINERVTQALKTVGMSDYAARYPHQLSGGQQQRVAIARAIAVRPRVLL 171
gi 490686766 104 LGLLFQNYALFPHLTVFENVAFGLRARRMSSADIARRVADALKLVQLGDAGHHLPAQLSGGMQQRIALARALVIEPDVLL 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 446851545 172 LDEPLSALDAQIRHNMVEEIARLHRELPELTILYVTHDQTEALTLADKIGIMKDGSLIAHGETRALYQHPPNRFAAEFLG 251
gi 490686766 184 LDEPLSALDANLRASVRSELKALHERLPNLTVVCVTHDRDDALVLADRALLMREGRVAQLGTPQQLYDAPADGFVARYLG 263
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 446851545 252 RANILSAIalgiteapglvdvscggaVIRAFSRGSHHGYNKLLCIRPQHLSLtpRSAYSNRFNATLQSVHWQGDLTHLLC 331
gi 490686766 264 AANLLPPN------------------VVFAFGDPRHDVRDKVACVRPERLAV--RPLGEGRLHGTIASVEWHGAALSLTV 323
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|..
gi 446851545 332 DV-AGETVRMV---LTHVNPLPRVGDKLALWFEPDDAVLIEV 369
gi 490686766 324 MLdAACDEPVLvtmQRGRGPAPERGARVSLDCEADDVVLISP 365
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap