1MRO,1E6Y


Conserved Protein Domain Family
met_CoM_red_gam

?
TIGR03259: met_CoM_red_gam 
Click on image for an interactive view with Cn3D
methyl-coenzyme M reductase, gamma subunit
Members of this protein family are the gamma subunit of methyl coenzyme M reductase, also called coenzyme-B sulfoethylthiotransferase (EC 2.8.4.1). This enzyme, with alpha, beta, and gamma subunits, catalyzes the last step in methanogenesis. Several methanogens have encode two such enzymes, designated I and II; this model does not separate the isozymes. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132303
View PSSM: TIGR03259
Aligned: 6 rows
Threshold Bit Score: 428.139
Threshold Setting Gi: 11514435
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MRO_C        2 QYYPGTTKVAQNRRNFCNPEYELEKLREISDEDVVKILGHRAPGEEYPSVHPPLEEMDEPEDAIREMVEPIDGAKAGDRV 81
gi 20532398   6 QYTPGETQIAENRRKHMDPDYEFRKLREVSDEDLVKVLGHRNPGESYKSVHPPLDEMDFEEDIVRDMVEPIQGAKEGVRV 85
gi 3334251    3 QYYPGTSKVAQNRRNFCNPEYELEKLREISDEDVVKILGHRAPGEEYPSVHPPLEEMDEPEDAIREMVEPIDGAKAGDRV 82
gi 126876     6 QYYPGATSVAANRRKHMSG--KLEKLREISDEDLTAVLGHRAPGSDYPSTHPPLAEMGEPACSTRENVAATPGAAAGDRV 83
gi 126881     6 QFYPSATKVAENRRNHINPAFELEKLREIPDEDVVKIMGHRQPSEDYKTVHPPLEEMDLAEDYVRDLVGPINGAKEGHRI 85
1E6Y_C        5 QYYPGATSVAANRRKHMSG--KLEKLREISDEDLTAVLGHRAPGSDYPSTHPPLAEMGEPAXSTRENVAATPGAAAGDRV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MRO_C       82 RYIQFTDSMYFAPAQPYVRSRAYLCRYRGADAGTLSGRQIIETRERDLEKISK-ELLETEFFDPARSGVRGKSVHGHSLR 160
gi 20532398  86 RYIQFADSMYNAPAQPYDRARTYMWRYRGVDTGTLSGRQVIEMRELDLEGVSK-ELVETELFDPATTGIRGATVHGHSLR 164
gi 3334251   83 RYIQFTDSMYFAPAQPYVRSRAYLCRYRGADAGTLSGRQIIETRERDLEKISK-ELLETEFFDPARSGVRGKSVHGHSLR 161
gi 126876    84 RYIQFADSMYNAPATPYFRSYFAAINFRGVDPGTLSGRQIVEARERDMEQCAK-VQMETEITDHALAGVRGATVHGHSVR 162
gi 126881    86 RYIQFADSMYFAPSQPYDRSRLYMSRFRGVDCGTLSGRQVVELRESNLEDISKnYLVDTELFDPATTGMRGATVHGHSLR 165
1E6Y_C       83 RYIQFADSMYNAPATPYFRSYFAAINFRGVDPGTLSGRQIVEARERDMEQCAK-VQMETEITDHALAGVRGATVHGHSVR 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MRO_C      161 LDEDGMMFDMLRRQIYNKDTGRVEMVKNQIGDELDEPVDLGEPLDEETLMEKTTIYRVDGEAYRDDVEAVEIMQRIHVLR 240
gi 20532398 165 LDENGLMFDALQRYVFDEEKGHVVYVKDQVGRPLDEPVDMGQPLGEDELKKITTIYRKDNIAMRDDKEAIEVVENIHTGR 244
gi 3334251  162 LDEDGMMFDMLRRQIYNKDTGRVEMVKNQIGDELDEPVDLGEPLDEETLMNKTTIYRVDGEAYRDDTDAVEIMQRIHVLR 241
gi 126876   163 LQEDGVMFDMLDRRRL--ENGTIIMDKDQVAIPLDRKVDLGKPMSSEEAAKRTTIYRVDNVAFRDDAEVVEWVHRIFDQR 240
gi 126881   166 LDENGVMFDALQRYEFDEATGHILYVKDQVGRPWDEPVDVGEPVPQEKLKEITTIYRKDGVAMRDDMEVVEVVKRIHRAR 245
1E6Y_C      162 LQEDGVMFDMLDRRRL--ENGTIIMDKDQVAIPLDRKVDLGKPMSSEEAAKRTTIYRVDNVAFRDDAEVVEWVHRIFDQR 239

                ....*
1MRO_C      241 SQGGF 245
gi 20532398 245 TMGGF 249
gi 3334251  242 SQGGY 246
gi 126876   241 TKFGF 245
gi 126881   246 TLGGY 250
1E6Y_C      240 TKFGF 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap