Conserved Protein Domain Family
methan_mark_3

?
TIGR03268: methan_mark_3 
putative methanogenesis marker protein 3
A single member of this protein family is found in each of the first ten complete genome sequences of archaeal methanogens, and nowhere else. This protein family was detected by the method of partial phylogenetic profiling (see Haft, et al., 2006). The functions of proteins in this family are unknown, but their role is likely one essential to methanogenesis. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132312
View PSSM: TIGR03268
Aligned: 6 rows
Threshold Bit Score: 683.778
Threshold Setting Gi: 20094233
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179927  12 VKVNGEEVELPDGSTVRDALEATGAPYVEGTLVCLISG-T-RELERTIDTYRIRTTTGSILLELL-PDDAP-GivEEWRR 87
gi 499725879   3 VKINDIEMDITAGSTVEDAIKLSNAPYISGTPIALIEG-R-QELESQVNKYKIETTGGSVIIELV-DNAELlT--DFWKK 77
gi 499343323  10 VEVNGQVYTLPAGSTLGDALKVSRAPYIAGAAIGILKK-AaEKRTEKITEYAINTPKGELRIEIKdPESTS-G--KLWAE 85
gi 499768539   4 IHFDGTITTVPDGFTIDDLLPDRDRSLC----IGILRP-V-TVSQAETKEFLIKTTAGEVVVETM-PGTCA-G------E 69
gi 499173342   4 VIVNGKE---KVGETLREVIK--DEYYNEGANIVIIKGvK-REAEKIPKKFLIKTTKGNITIAIT-ENNET-A--KFFIN 73
gi 499328673   3 VYVDGEPVDVPEEATVRDALEAAGVSVPEDVTIAVFKG-E-QKVERETDRLRIMLETGDEELSLT-VAVED----ERMSE 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179927  88 IYTELENMRIRWTTPSEIAMGPLR-TELE-PSRDEFTYDEDEVIMSLSGFSPDSTHIIISKEPHSAVYGVPRENrGVFAR 165
gi 499725879  78 NYKKFINKVIRWTTSQEVAMGAVK-SDLE-PTNNEYLYNRWDVIISLSGFSNEATHIIFSKSKHQSIYSVPNQNkGIVAT 155
gi 499343323  86 HYKEYEGKDIHWESPEALAFGPFE-ADIK-PSRETGNFEAFDVLFGAGGFDPHNTHLILSRKRHSAEYGSPDD--GVFAS 161
gi 499768539  70 ILTGLSGIQSGWHDLQVASFGPFP-SSFT-PSRKPSRYERGDLALGCGGYDPARSFLVFCKKTHAADHGGPVEN-GIIAK 146
gi 499173342  74 NYKDFV-KKLRWVSGMDVAFGSTT-IDLE-ISTEPKEFKKWDVVLSISGLDKDEGHIVFIKKKTEGVYGLKDPK---IGI 147
gi 499328673  76 VCEELPGASVSWTTRDEVGLGPVDvSDLEfHTRRGVEVPPYTAILILPTNDPSEAYFLITKRRMAVEYICTD----IHGR 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179927 166 ITGGKRTVERLTQDDVVKSVEPVVERKSIVESAAVTDLNTELEDGNQLFTYVKVK--------PSPESPQSVEHFFSM-- 235
gi 499725879 156 VVGGKRNILKLKNTDEIINIEPIIERKSVINSASVTDLSTTLKEGNELFTYVEIE--------ANHEAPISFEHFLKI-- 225
gi 499343323 162 IVTGRKIISKISKEDSILSIEPVIEWERITEKTCTTDLSTPLEDEDSVYTYFEVE--------LSRNAPVGAEHFYAL-- 231
gi 499768539 147 VISGMGVLDRLSDSDQIISIEPVISFAESSDARTTTDGSVVLEEGMHIITHIRVQaegktldgYDPKTAVSVDRMLLA-- 224
gi 499173342 148 VVGGKWVIDRLEVGDKIIDIEPIREEKEAVDYLVTTDLDLKLEDGWRIFTYFTAE--------FD-GTPSAVEHCLAL-- 216
gi 499328673 152 VTAGRELVDELRGGERVTHVEPVVERATERVVSRVT-LDDGLEAGDRIITRVEIE--------LEKNAPVSAEHLLNTle 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179927 236 VEDGKLRVDYEANSFIGFYSLQGIKKDPEKIDKRNRGAVTLRNTGRGSGRVYIYREDRVSTPSHNLIGHVTEGMELVDIA 315
gi 499725879 226 IEDGTFYVDYESESFIGNDKLRGLEKDSEVIEKRKRGAVTLRNQGAGVGRVYIYREDRVGVPSHNIIGYVSRGIQLLDTV 305
gi 499343323 232 TREGTLKVDAVTSSFISDDSLREVPAPYENFEQRREGAISVRTVGYGTGRIYISREERPSSLVHSVVGQVTKGLELIKLA 311
gi 499768539 225 LLNRVFIVDKRLSTHIRCDVLTGTDVPCEACSGRREGTVLMRTSGKNRGSLYIYTQDLPRSLAHTVVGHVVHGIELCKIA 304
gi 499173342 217 MEDGIFEITENTNTYVADCRLQTLKIEEGNLIDRERGFITVRNYGVGEGKVYIYRESRSSSLSHTVVGRVKEGIELIDFS 296
gi 499328673 223 MEEGRLRIKFRTDTFTSIEPRPFYDLPEENVDMRERGVVTVRNRGVDEGVVYVYRRDRTPVESHNVVGRVRRGMELLDVV 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179927 316 GEGDQITVECEPGRIMTVAMTQKEAEDYLREYGIEQIREGIMDDDAIVVVQDPPYTMDILREGKVRTLGIDPDKILEIEL 395
gi 499725879 306 KEHEKITIKTVPEKISTVALTQKDADIYLENLGIEHERDGLVDDDAIIVAQDPLYTVDIDKQKKLKTLGVPKDDFVEIEL 385
gi 499343323 312 EKGQKLSVESLPPQIVLLGHSFEEVEPLLSSIGVELIKEGYAGENSVIVRQEPPTTLEILGEAKVKAYAVARTKLIEVEL 391
gi 499768539 305 QEGDRLSIQIEPSQVDLIGLPLAMARERAEALHLTLTPD-VDGPDRVVIKQKPATTLEVLAQGLVEVETIPDKQVISITL 383
gi 499173342 297 DSG-VLSVKXVPERLCAIGLTIEEAEEMFKKYNIEVEKEG-DLENAIVVEQEPEYTLDVLKEKKVKIRGLDKNKIIVIEL 374
gi 499328673 303 AEGDRVLVETDPPRVNFVGLTVDEARELAEEFDVELEVNG---DGDVVVDQEPRETLNVLKERKVRVEVVPEDEVIEIEL 379
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179927 396 -DPAAPRSSWYFRRLTGLIDTPIGSLKVHFAFPG--MkvVMFEGDKSLA--KGLIPENTPERCVKKGNIGITNMSRRHIG 470
gi 499725879 386 yADENPSSVWYFRKISGLLNGDVGHLRVNMAIKE--MniIMFKAVNKEA--KGLIPEKLPDNKVNAWEICVSNTACKHVG 461
gi 499343323 392 yTEIAPKSIDFFRHALDLKTKTVGKLPVHMIYET--T--YLFKTEKEMVkyKEILPENTPEKKVLAGEIGITNQAAKRMG 467
gi 499768539 384 dDVNAPRTCKIFREFSGLKYHAVGRLPMLFSFDE--V--TLFKAKIPKT--TNVIPENTPVSSVEAGVLAMTNDSCKGVG 457
gi 499173342 375 fEDKAPITAWYFRKTTGLTTKRVGKLHVYFKHKD--I--VMFKGNPEYA--KGLLPENIPTDKVEPCSIGVTNMVSRYKG 448
gi 499328673 380 yEDDAPRSVEYFRRVTKMLDRPVGRLKVHFAYADlgM--IVFEGNEKLG--KKLPPENNPKDRVEAGVLGVTNQAKPHAG 455
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|.
gi 499179927 471 MVGVRLEDNDEYGPTGEPFNGTNMIGKITGGIENVEKLKEGD---TVYVRE 518
gi 499725879 462 NIGIRFEDNSEFGPTGESFSATNVIGKVVAGFDNLKAFKEGD---TVYVKE 509
gi 499343323 468 TIGVRLIDDDLFGPTGEKFSSTNIIGRIVE-PDRLKGIKEGD---AIYITE 514
gi 499768539 458 IVGVRSVPSSEFGPTSEPFSGTNIIGTVID-MEKIAGLEEGE---VVFFRE 504
gi 499173342 449 MIGVRLGESDKFGPTGESFEKTNIVGGIVENAEYLKNVKTGD---DVYVLL 496
gi 499328673 456 LIGVRLEDSEEYGPTGETFEGTNVIGRVVEGLGRLREMDQSDmgrTVYVRE 506
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap