Conserved Protein Domain Family
methan_mark_5

?
TIGR03271: methan_mark_5 
putative methanogenesis marker protein 5
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132315
View PSSM: TIGR03271
Aligned: 6 rows
Threshold Bit Score: 245.01
Threshold Setting Gi: 84489822
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499328457   6 RVFIHPPNSLILHDLVERFGHEPLSLPKEISKRVRDPEIDSPPMNVTPQDAKRGLKYAAVEVPSGVRGRLALIGPLIEKA 85
gi 499819196   3 KVIIYPTNSLILSDMVERFGHEPLAMMEKIKEIINTIGVDSPPLNITPEGPKHGLKYAAVEVPAGVRGRMSLIGPMIDFA 82
gi 499179930   2 KIAIFPPNSLILADLVERRGHEPLVIQKEIKKKVTDPEIDSPPFNITEEDPIRGLKYAAIEVPSGVRGRMSIFGPLIEEA 81
gi 499172316   3 KIFIYPPNSLILTDLVERFGHKPLNLNIVIGKLVRNPEIDSPPMNITDEEPKKGLKYAAVEVPSGVRGRMALIGPLIEEA 82
gi 499768537   3 EVFIYPATSLILSDLVARFGHKPLGTALSVRERIQTAGLDSPPLQMTPDDAKKGLRWAAVEVPSGVRGRMSLFGPLIDRA 82
gi 499725876   2 KVAIFPPNSMILADMVVRCGHEPLVVQKQMKQKVTSPDIDAPPFNMTEDDPISGLKYAAIEVPSGVRGRMSLFGPIIEEA 81
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 499328457  86 DAAIVVTGiEDFSFGCLGCDRTNEFVTYLVRRQGIPVLELEYPKSEEEAKAFVREIRDFLESL 148
gi 499819196  83 EAGIIVGD-SSFSFGCMGCARTNELTKFLIREKDIPILEIQYPHTEEDGQDFVYKIADFLKSL 144
gi 499179930  82 DAAIIMEE-APFGFGCIGCARTNELCVFQLRKRGIPTLELKYPRTREETIDVVNKINNFLDEL 143
gi 499172316  83 EAAIIMDD-APIAFGCIGCQRTNELTLYLVRRKNIPILRVKYPTNEEEAEILVNKIANFLKSL 144
gi 499768537  83 EAAIIVRN-PDFAFGCMGCARTDELVEFLVKQKKVPILELDYPADEEEGIIFVRRVKEFLTGL 144
gi 499725876  82 EAAIIMNE-APYGFGCVGCARSSELTVFSLRRKDIPVLELDYPTSRDATVEMVHKINTFLDNL 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap