Conserved Protein Domain Family
methan_mark_7

?
TIGR03274: methan_mark_7 
putative methanogenesis marker protein 7
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it.
Statistics
?
PSSM-Id: 132317
View PSSM: TIGR03274
Aligned: 6 rows
Threshold Bit Score: 439.159
Threshold Setting Gi: 20094021
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499768534   3 LVPITYKGGVFRHDEILDLIEDMGGYIIQKHMIAQEVVLQALIPKEDIEILKTVSRPLAGEVKPAPLVGTEIAVVSMSLE 82
gi 499179264   2 YETLTYQGGVHRHEEMKELIEDLGGFVLQENMLQMDLILTLAVPIDDVDKVREKARELLGKIKVAPMAGTEIAIVSPTLA 81
gi 499725160   2 YETMTYTGGVHKHYEIEELIEDLGGFILQKNESQIDITLTIAVPSEDTDKIEAKAKELLGSVELSPLASTEIAVVSPTLA 81
gi 499343328   4 LLPYLYTGGVHKHGLLIELMEDLGGYIIQKVVTGTEVNLIMLVPEKDVDIVKKLSKELLGILVEAPLTGVEIAVVSPTLA 83
gi 499171999   6 YEIVRYEGGVYKNNIFKEWIEDIGGFVIQEHVMQLDVYMTLAIPQNELENIKEEAKKYKGKIIETPLAGTEIAVVAPSLS 85
gi 499328461   7 FETVIYEGGVYKADEMRDLVEDLGGFVLSEHQMQLEVHMVLAVPVDDLDVIERKAEELLGEIRRMPLAGTEIAVVGMSLA 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499768534  83 IHHLPHASCDVAEYLRTAGAKTNMIGLARGFGKRIGLLSDEERDIINEHDLAIYLFGNFETCI-KEKMPTFRRgI-QVPI 160
gi 499179264  82 RHHLPHSACDISEYLRRYGAKDNMIGLARGAGKGISRISEDEKRLIEEHDLAVFALGSFEQCI-KDKVHLFSD-I-KIPV 158
gi 499725160  82 RQHLPHAACDIAEYLRRYGTKTNMIGLARGAGKGIAQINKEEKDLIEEHDLAIFSLGSFDDCI-RKKKFLFED-I-DIPV 158
gi 499343328  84 SHHLPHSACDVAEYLRHPGANTNMLGLARGMGRRVSLSMDYERKLINEHDIAVFTFGSFSDCItKKKPKLFEG-I-EIPI 161
gi 499171999  86 RHHLPHTACDISEYLRRFGAKPNMIGLARGVGRDIAQLREKERRLIEEHDLAVYVMGNFEDCI-KNKTHLF-D-V-DIPV 161
gi 499328461  87 RHHMPHPVCDIAEYLRRHGAKSNVIGLARGYGRELAQLRTREKRLLEEHDLVIFVVGNFKDCIeKYKLPLVRR-IeRVPV 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499768534 161 VVCGGPTKETLMKIidPPVAGYIGGLGRFMHRTKEPHELARLDEIVEEVSRVIDQKRIGIAKDPLSVTPARLMDIILENV 240
gi 499179264 159 VVTGSPDEIDLRDL--PGADAYVGGLGRIPRRLKRGEDIRALRKLVEVVEGLLDKRSRDMAADPPLVPSILVKSEIENQV 236
gi 499725160 159 IVTGSPEIVA--EE--INANAYVAGFGRIPRRLKRGENIRALKKLVKTSEDIISKQKEELSDDPLIISPVIVKITLEREL 234
gi 499343328 162 VVTGGPSDLKTEDI--QGADLYVGNIGRVSHRLRRTEEVNALENLNQEVSKIADSIRKQQARDPLAVLPARVMKEIENQV 239
gi 499171999 162 VVTGGPEKIDI-PY--P----YVGNLGRRSHRLRHGEEIRALRKMVEVITELINERRRELSYDPPIVPPVVVKDEIEKQV 234
gi 499328461 166 VVVGGPEEIDADDV--V----YVGGIGRKPYRFRKGREITKLDEIVDVVSKIIEERRQELAEDPPVVPPMVVKDRINREL 239
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 499768534 241 PAIHEVTSPIPVVVQMDGTRIKLPYDPYAAEIREIEI-EaGIRIADVCDIRPSRMRDYILLKVKPFSET 308
gi 499179264 237 PAIKEVYSPTPVTSQLDGVRVKLNYDRYHEEIADVRV-S-DYRLGDISEIRKSMMYDYILVKLLPESSV 303
gi 499725160 235 PSIKDVNAPMAIVSQLDGVRVKLPYDEYYKEVANVVV-E-GYRLGDIAEIKKSKMYDHILVKILPETSI 301
gi 499343328 240 PEIRTVLSPAPLTLQLDGVRVKLPYDQFHEKIEKLEFdE-GVTLSELANISRSKMKNYILIKIKSKSDI 307
gi 499171999 235 EEVYSILSPMPIVTQLDGLRVKLDYDKYADKIREVKV-K-NYTLGDIADIKRSEMKNYILIKIKPKSEV 301
gi 499328461 240 KIEERFTSPMPITLQLDGLRVKAPYDEWADRVAEVEV-F-GWKLREIADIRRSEMDDHILVKIRPKSAV 306
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap