Conserved Protein Domain Family
methan_mark_8

?
TIGR03275: methan_mark_8 
putative methanogenesis marker protein 8
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it.
Statistics
?
PSSM-Id: 132318
View PSSM: TIGR03275
Aligned: 8 rows
Threshold Bit Score: 385.228
Threshold Setting Gi: 20093590
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499484948   6 HVMEVLGNA--KVTVKNG--KVVDVSDPIISFCPLFAKHRG-INEINKESIQKNVEFRIESFGLFTKNRVVLDDSpFVGF 80
gi 499345230   3 HIMELLGKT--RVVVKDG--KVIEVGEPEVKWCPLFAKIRG-IQKITPDEVRKNMEFRISDFGMFTDKRRLELED-FVGF 76
gi 499768981   4 HIIEAAGRC--RVVVRDG--KVVEVGSPLITECPLARRFACpVNEMTSEAIRDNIQNRIDSFGMCTPGRELTSDEvFVGF 79
gi 499345227   3 HIMEMMGKA--RVVVKDG--KVIEVGIPEVEWCPLFVKLRG-VEKMTPDEIRKNMEARISELGMFTENRRLEFETtVVAF 77
gi 499725109   6 HVIEALGKT--RVTIENG--KVSNVEKPLIEYCPIFAKYRN-IEEITPELVRENIQFRIDDFGMCTKNRQIKMSD-MLSV 79
gi 499171959   4 HVMEALGKA--RVVVENG--RVVEVTEPKIKYCPLFAKHRG-IKEITKESIKENIEFRIKDFGLFTKNRVVEESRyIVPF 78
gi 499179642   7 HVIEALGKS--RVTVRNG--RVVDVSEPLIDYCPLFHKYRG-IEKITSEAIRQNIEFRIKDFGMCTGNRELRMRD-FLSF 80
gi 499328030   6 HMMECLGKTpvRVIWKDGdvEVRAEGDPMIERCPLMRRREG-FSKLTREAAERHVLNKVNEVGMFTPKRRIRSCRrYTPF 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499484948  81 GTSEIFMSALKKGFLDAVVVVSDCAGTVVTNNPKLVQGLCGRISGIIQTTPIKEVIEKIEKANGIVLSKDDASIDQINGV 160
gi 499345230  77 GASEVMMTGLSRGLLDTTVTACEGAGTVISNNPTLVQGMGGRMSGLVETEPIEGIINGITERGGIVLDPSTAKMDPAAGV 156
gi 499768981  80 GASEIISTALKSRFIDAAVIVCDGAGTVVVTKPEMAQGIGGRMSGLISTSPIPDVIRRIEDEGGIVVDPDHAFLDPIAGV 159
gi 499345227  78 GASEIMMSGLTSGFLETTVTACDGAGTVISGNPALVQGIGGRMSGLIETEPIDALIRGIEERGGTVLDPATATIDPAGGV 157
gi 499725109  80 GISEILRSNLEVGNIDCVVGACEGVGTLLMTDADIVQGVGGRASGLVSTTPIPEVMEKIGIEN--VLDAQTAQLNPIKGL 157
gi 499171959  79 GASEILMSALKRKAIDVAVIVADCAGTIITSNPNLVQGLCGRISGIIETSPILEVIEKIEKAGGVVLNKKTAEINQFEGV 158
gi 499179642  81 GISEIISTLIEEGEVDAAVMVCDGAGTVIVTEPELAQGIGGRISGVVETSPEDEVIGSIGPEK--VLDPEKATIDQVKGV 158
gi 499328030  85 GVSETLMTCLQHRLIDAAVIVSDCAGTVVTDKPAIVQGLCGEISGIRDTDPIPEVVDRLEDSGCSVL----GRIDQREGV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499484948 161 KLAIKLGYKKIGVSVSNLKDALEIKKLEKN-DIKIITFGVHTTGIGLSDYDEYLQYIDLISACASKNLLKSKSFniKAQA 239
gi 499345230 157 KKAAELGYKKIAVTVAFAETAKEVRKLESElGLDLIVIGVHVTGLDREEAQALVENSDIVTSCASKSIRDLVKP--LAQV 234
gi 499768981 160 RAAKMAGYEHLIVTIHNPEDARAIREYDS----DAIIIAVHTTGYSHEDAEKVKQYADIVTACASQTIREICGPcaILQA 235
gi 499345227 158 RKAAELGYKKIAVTIADAKTAKNVRKIESEsGLDLFVIAVHVTGISREEAQELLDNSDIVISCASKYIRELAKP--LVQV 235
gi 499725109 158 EKAINEGYKNIAITILPSPLIKKIREYDLPsDVNVYLFVAHTTGISMDETKDVFKYADIVTSCASKNIRDYASKikPYYY 237
gi 499171959 159 KKAIELDYKKIAVTVTNLEDAKRCKSLEND-EIKILTFGVHLTGI--EGSEEIAKYFDLVTACASKVLREKLKGkiKAQI 235
gi 499179642 159 ERAFEMGYDRVAVTVADPAEAERLREMD---GGEIYIFAVHLTGIDYRGAEKVINTADVVTSCASKYIRRIADRraLLKV 235
gi 499328030 161 EIALEEGRRFVAVTVADAGDAEAIRE---EfGDDVLIAAVHTTGTDEEDAERLVQYCDIITGCASKAVRRAAGRryILKV 237
                        250       260
                 ....*....|....*....|....
gi 499484948 240 GSGVPIFALSNSGKELLFERLKEI 263
gi 499345230 235 GTAVPLFALTQKGKELVIERAKDI 258
gi 499768981 236 GSTVPVYALTSGGKHLILLRMAAI 259
gi 499345227 236 AAAIPLFALTKKGKELVIERAKDI 259
gi 499725109 238 GSSVPIYAVSDMGRKFLDTRLEKI 261
gi 499171959 236 GKTIPIFALSDFGKEILLERAKDL 259
gi 499179642 236 GSAIPVYACTKNGKRFIELRIKRM 259
gi 499328030 238 GSRVPVYGITPAGAEALWLNVREL 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap