Conserved Protein Domain Family
methan_mark_9

?
TIGR03277: methan_mark_9 
putative methanogenesis marker domain 9
A gene for a protein that contains a copy of this domain, to date, is found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. A 69-amino acid core region of this 110-amino acid domain contains eight invariant Cys residues, including two copies of a motif [WFY]CCxxKPC. These motifs could be consistent with predicted metal-binding transcription factor as was suggested for the COG4008 family. Some members of this family have an additional N-terminal domain of about 250 amino acids from the nifR3 family of predicted TIM-barrel proteins.
Statistics
?
PSSM-Id: 132320
View PSSM: TIGR03277
Aligned: 6 rows
Threshold Bit Score: 204.212
Threshold Setting Gi: 15679032
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499766972 256 GWYNAPKQLCRGGDIRSLAFCCMPVKPCPLLPKLQHYNISPQEFVTMKMEAVAGTPLEQGANTCFGSLVYCCKDTTPCMF 335
gi 499726242   2 GWDDAPAHVCRGGDIRGLAFCCPPVKPCPVHTKLAEVGLSPQEFVNIKEEFGKKTELGKGTGTCFGSLIWCCKASKPCPL 81
gi 505225029 262 GWYNAPKHVCSEGDFRGLAFCCLPVKPCPVHAKFKKLGYTAEEFARTKLEFARGTMLEFGEDTCFGSLVWCCKITKPCWI 341
gi 499329308   7 GWPDAPSHVCRGGPPEALAFCCPPVKPCPIFHALDEAGLDPEEYVRRKKEFAEKTPLGSGKNTCFGSLVWCCKITKPCPL 86
gi 499172020   2 GWENAPSHICRGGDLRGLAFCCPPIKYCPIHKALAVLKMSPEEFIRIKEEFGKRTKLGLGENTCFGSLVWCCKITKPCPY 81
gi 499179105   2 VWSDAPSHVCRGGDKRALTFCCPPVKPCPIMIALEEAGLTPQDYIEIKESFAKRTRLGEGQGTCFGSLVWCCKPSKPCPL 81
                         90       100
                 ....*....|....*....|....*....
gi 499766972 336 RDAALRQAGIKKSTYMDLKREISKKLLKK 364
gi 499726242  82 RDSVLQSIGMSHDTYMTLKKELANEIVKH 110
gi 505225029 342 RDGVLNTIDLSDAEYMKLKEKLAKHILDN 370
gi 499329308  87 RDSTLQRIGMSPEEYMWWKKKLAEYLLGK 115
gi 499172020  82 RDYELAKNNISPDEYMELKKQLAEEIIRN 110
gi 499179105  82 RDMAMKRINMSTEEYMELKKKLSEELVGT 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap