Conserved Protein Domain Family
methan_mark_10

?
TIGR03278: methan_mark_10 
methanogenesis marker radical SAM protein
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. It is a radical SAM enzyme by homology. The exact function is unknown, but likely is linked to methanogenesis. In most genomes, the member of this family is encoded by a gene next to, and divergently transcribed from, the methyl coenzyme M reductase operon.
Statistics
?
PSSM-Id: 132321
View PSSM: TIGR03278
Aligned: 6 rows
Threshold Bit Score: 698.392
Threshold Setting Gi: 20094088
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179254   7 LGGIPGKDCRGFCRYCYFRKVGEF--EAFGCKNCSPGRVGCETCGKGVaEIGNEFLPPFLVMGNVQTTLmMGNFqdRDVK 84
gi 499725174   7 VGGIPGKNCRGFCEYCYFKKVTQK--KVLGCKNCPPGQIGCPHCTTDT-NMTRDYFPPYQVLSSLQTNI-FQTRlpKDTL 82
gi 499343655   7 VGGNPGVDCRGFCKYCYFKKVKDV--QPLGCKYCLPFKKGCDYCTRSVkESYSGFKPLQMVLEETANKLyFATG--EVKK 82
gi 499768736   8 IGGRPGIDCRGFCAYCYFKHAQDL--PAFGCKYCLPFTKGCDYCSRSVqEKYSGFIPLQEVAGKVLADLqMLTG--DLTR 83
gi 499172768  10 LRGEPGINCNGFCKFCYFRKVNKNnpQPFGCRYC-QFTVGCDYCMYSVrEINGDFIPLPFALMELQSSLlFK----RYSK 84
gi 499328528   1 MGGRPGVDCGGFCRYCYFRGVDWEekRPFGCKNCPPGSPGCDYCGRSVwEDNGPFRPPGVVLQEVGMSLgFR----RERE 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179254  85 INISGGGDVSCYPHLEELTAGLGEFGIP-IHLGYTSGKGIDDPGIASRLIENGVDEVTFTVFSANPDLRREWMRDENAfQ 163
gi 499725174  83 VNITGDGDVSCYPHLLELTKGIHDMGLP-IHLGYTSGKGIDDVSTVDKLINNGVIETTYTAFSTDAKLREKWMHDPTA-D 160
gi 499343655  83 FTVSGGGDLSCYPELKNLITFLSQFNTP-IHLGYTSGKGFSKPDDALFYINNGVTEVSFTVFATDPSLRAEYMKDPEP-E 160
gi 499768736  84 ITISGGGDPSCYPEFTDLMELLSSLEAP-IHIGYTSGKGFDNPDIAEFLIENGLREISFTVFAHDPELRRKYMKDPTP-E 161
gi 499172768  85 VNLTAGGDVSCYPQLEELCKAINNIGLK-IHLGYTSGKGFDNVEIAKNLVDYGVDEVTFSVFSTNPKLRKEWMNDKNA-E 162
gi 499328528  77 ATVSGGGDISNYPWLRELVASLRDLGIRsVQLGYTSGKGFEDPEEVEELCDLGVRSVSYTVFAWDPELRREWMGDRSP-E 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179254 164 GPLEALRIFCESCE-VHAASVIIPGVNDGDDLLETCARLEEWGATGFIMMRFANYEHQGLILGNEPIIEGVEPHTVSEFE 242
gi 499725174 161 VSIQALKRFCESCD-VHAASIIIPGVNDGDILAKTCADLESWGAKALILMRFANTANQGLILNNGPIIPGIKEQTLTEFE 239
gi 499343655 161 ASIQVLRDFCAHCE-VYGAIVLLPGINDGEVLEKTLSDLESMGAKGAIFMRFANFQENGLILNNSPIIPGIIPHTVSEFT 239
gi 499768736 162 ASLETLHRLAQKIE-VYAALVILPGVNDGKVLIDTIRWLEKAGVKGAILMRFANTPEQGLILQNAPIIPGQRIHTPLEFA 240
gi 499172768 163 TALKCLRYFCENCE-VHCAIIVIPGVNDGEELKKTVSDLVDWGANAVILMRFANSEEQGLILGNAPLIEGIKPHSVEEFK 241
gi 499328528 156 ASLACLEVFADRCEeVMVAAVLIPGVNDGDVLWKTCERLEELGIDALLLMRLGTREEHGIILGNSLVLD-VKPHSLDEFK 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179254 243 ELVRAIDREFN--LRVTGTPVCDPQNGTPFVLAADSSrEYLEILPE-IQGEATIITGSIAAPYIRRIIHNLGADDLVNVV 319
gi 499725174 240 NLVRETAKNYN--LRVTGTPVCDPETDAPYALSKDKNkEYLEILTP-VRAEATIVTSKISAPYIEKILENLNAADYVNVV 316
gi 499343655 240 EIVRSSAAKHPs-MRITGTPLEDPLIGSPFAIRNVP--EALSKLPG-VTKKATVLTGQVAAPRLTEIFDALGGS--VNVV 313
gi 499768736 241 DLVKETQKITS--IRISGTPLYDPDLGSPFILAHEP--DHLQTLPM-ISKCAGVITGAIAGPFLDQILRARGGENLIFMV 315
gi 499172768 242 NIVDEIHNEFGdyIRVTGTPLHDPVAGTPFALAKEENsHILERLKDkINGEATIITGNVAYPFLKKIFDETS----VNVV 317
gi 499328528 235 RIVTEVHEEFP--FRVTGTPLWDPETSAPFALRTLGE-ELRELLPP-VEVECSLITGRVAAPLIREVFRHVEGGEKVDVV 310
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179254 320 GVNKDIACLITLRDLEEVDPGDLRETVIIPGRAFVHDMQAREVLSRDGVDRIVVRGPDRLTVDGEMSGTLSEYDVIEREM 399
gi 499725174 317 STSQEIACLITEHDLREIDLNEVKDTVIIPGRCYVHDLVAEKIFRSDGKFRLIHRGPDMLTADGEMSGTLSKNDVLKQEL 396
gi 499343655 314 PLKKDIGCLITIDDFRNLDLSEVTETVFIPGRAFVHDMEVREALKKDGVDRIVRRGPERLSVDGEMSIGMTREEVLELEI 393
gi 499768736 316 --KKEIADLITIDDIQELDLSTMPDTIILPGRSFIHISEAEKVLSADGRSRIVIRGPDMLTADGETSMGMTRDEVLALEL 393
gi 499172768 318 KVNKDIADLITAKDLEKLDLKDVKETVFIPPKAFVHDRVAEEILRRDGVDRIVVRGVEQLTLDGEVSGIYTREEALKFEI 397
gi 499328528 311 PVEKDVACLITERDLERLDVSSLKRTVVLPGRALVHDARAEELLKRDGFERVVLRGPDRLTLDGEASCEVDREEVLEFEL 390
                        410
                 ....*....|....*
gi 499179254 400 EAFYELIQAINFFGA 414
gi 499725174 397 MAFEDLIELINYMGV 411
gi 499343655 394 EGFTELINQINSLGL 408
gi 499768736 394 EGCRTLINLINQWGS 408
gi 499172768 398 EAFEELIGMINFFGM 412
gi 499328528 391 NAFRDLINTVNILGE 405
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap