Conserved Protein Domain Family
methan_mark_12

?
TIGR03281: methan_mark_12 
putative methanogenesis marker protein 12
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132324
View PSSM: TIGR03281
Aligned: 7 rows
Threshold Bit Score: 430.338
Threshold Setting Gi: 88601752
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499724905   4 YMGMDHGTTAISFEIIDENKEEvsYF--KLNRDK---LSKKEIFFkdIINDKIDIKKVKLLAMTYAMGDGISKITPIDLV 78
gi 499173300   3 TVGIDHGTSGITTCIKDNDKKI--IF--KLKRTE---LKEKSYLE--ELEKHISLEDIDLIALTYSMGDGINKILPIEKV 73
gi 499179511   6 FVGMDHGTTGVSFTILGDDAE---HF--KIGRED---LSTGRASAldELKDRVPLNEIDLMAITYAMGDAISTIKPIERV 77
gi 499483946   3 VVGIDHGTSGITACVMENKTVKs-VF--KMKRTE---INEKSFLK--ELEKQVNLNDIDLIGVCYSMGDGIDKITDIKRV 74
gi 499343091   3 FIGVDHGTTAMRFALIEGEKVL--TF--ELGRSEaaaMSEKEILEsiEKEFEVKVKDIDLIALTYSMGDGFSEIKDVKKI 78
gi 499327958   5 YVGIDHGTSGIKVAAYDGEGDP--EFlgKAPRRK---VAERGLLRslPDEARRAVEEAECICLNYGMGDALTEFTPLEEA 79
gi 499766765   2 FVGIDHGTTAMRFA--GGEK----VY--KIPRAD------AVSFQlsDLLHLTGGEEIEGFAVTYSMGDNFSDITPVAHL 67
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499724905  79 KD----RGIQSINGAGKVTGGGTTVYEDIMELNIPSVLIPGLHSGCEFLDDRFRASYSHCGSPEKVSLSYYAYLKTGFKN 154
gi 499173300  74 KN----RGVLSIEGAGEKVGGGTKVYDEIKESGLPAVVIPGLHRGIECLDERFRALYSHIASPEKVSIAYYAYKLFGFND 149
gi 499179511  78 KN----RGIISIGGAGKVTGGGTAVYSEIESSGIPTLLIPGLHRNTPCLDERFRAAYSHHASPEKVSICYNAYLETGWEN 153
gi 499483946  75 EN----RGVINLEGIGKKIGGGTKVYDEIKSSNIPAIVIPGLHNGVKSMDKRFNALFSHIASPEKISICYNAYKTFGFEN 150
gi 499343091  79 EG----RGLQSTEGAGKKTGGGTRVFDAVKNSGIPAIAIPGLHTRSK-VDPRMK-VFSHLTSPEKLGIAYHIRCM-GYKD 151
gi 499327958  80 EDlgvgYGLRDTSGAGREFGAGRRMVEELSELGVEAYLAPGIHRDLPRLDGAFR-VFSHVASGEKLGTARLALELSSSKD 158
gi 499766765  68 KN----RGLVSREGAGEHTGGGTRVFDVIRESGIPAVAVPGLHRGSP-TDPRFK-VYSHQASPEKIGLAYEVVCQLG-PT 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499724905 155 MIIADISSNTVCILVEDGKIKGAMDACVGAMGFIHGPLDLDMIRDIDSGKKTANEAFSHAGISKIA-CVDSQINNVKDDI 233
gi 499173300 150 FVLSDISSNTVTLLIKDGKIFGGFDACIGAIGMLHGPIDLEMIRDIDAGKITANEAFSKAGAVKIA-KLYKGVENTKEEI 228
gi 499179511 154 MIVSDISSNTVTMLIQDGRIVGAMDACVGAMGVIHGPLDLEMLRKIDDGEKTANECFSHAGAVKIA-GIDTKVSRAREEL 232
gi 499483946 151 FILSDISSNTVTLLIKDGKIFGGFDACVGAVGILHGPIDLELIRNIDADKITANEAFSKAGVVKVT-DSYKGVEDTKFEI 229
gi 499343091 152 FVVSDISSNTVTLAVASGKVIGAIDACIFAPGVHHGPLDLEAIRNVDDGLRTANQAFMEAGALKMT------PYKDRGEL 225
gi 499327958 159 IVVCDTSSNTVSVVVKDGEVIGGIDACLGAPGVLQGPLDLEAIRRIDAGELSANGAFSTGGIVKIVnCAGEDPESAVEEF 238
gi 499766765 141 CIVSDISSNTVTLLIQDYRIVGGFDACLFAPGWVHGALDLDAIRAIDAGKMTANDAFLHAGVRDSL-------------- 206
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499724905 234 LEKAlHNDKKGLLAIRSLVMSVIMEIYGLY-GImENKIDGIVLTGS-GGCMTSPINISGMIKEKIEr-iCPVYVLGSDSG 310
gi 499173300 229 INNY-FNDENCRLAVDSLILSVSMEINSLLpLL-DKNKRRVVLAGS-IGTLRNPIDIPKRIKEFVE---AKIFVLYGESG 302
gi 499179511 233 LEMYrAGRDEARLALDTMMMTIAMEIWGLA-GI-SSGIDGIVLTGS-VGAMREPYDFHGKLKDMVKe-iADVRCTDSHLR 308
gi 499483946 230 MNNY-DKDEKCKLAVDSLVLSVSMEINSLM-FL--TPDKNVILAGS-IGTWENP-NVSKMIKENID---GNVLVLNRESG 300
gi 499343091 226 LNAAeNGEEPALLALDTISLFAAMEIVSMQ-LL--LKEYGVTGAAFlAGSVGEVEYVQKKISRHLG---QECLSLGKWHA 299
gi 499327958 239 IQRC------GKEEKEWLARLVAWEVAGLG-VVyDCDEAWI------GGTLSGDDEFMGVLERVLSkafNKVAGLPPESA 305
gi 499766765 207 -------DDPDREA--ALAMFAAMECASLR-LL--APEAPVALCGSrAGSVADE------IARLLS---CDLLILDEWTA 265
                        330       340
                 ....*....|....*....|....*.
gi 499724905 311 AIGSSYIAYDIEKNKVDkIMGIDVIY 336
gi 499173300 303 AIGGALIAEDILKGKRD-ILGIEVEF 327
gi 499179511 309 LHGKCQIARDIYNGKRE-ILGIEVEV 333
gi 499483946 301 AIGSAMIAEDILNGKKE-ILGIPVDF 325
gi 499343091 300 AIGCAGIARDVFAGENH-ILGIDVDY 324
gi 499327958 306 SMGLALIAADIASGARS-VLGVRISR 330
gi 499766765 266 AKGLSRIAEAVFSKNVTqILGIPVRL 291
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap