Conserved Protein Domain Family
CoB_CoM_SS_C

?
TIGR03290: CoB_CoM_SS_C 
CoB--CoM heterodisulfide reductase, subunit C
The last step in methanogenesis leaves two coenzymes of methanogenesis, CoM and CoB, linked by a disulfide bond. Members of this protein family are the C subunit of the enzyme that reduces the heterodisulfide to CoB-SH and CoM-SH. Similar enzyme complex subunits are found in various other species, but likely act on a different substrate.
Statistics
?
PSSM-Id: 132333
View PSSM: TIGR03290
Aligned: 7 rows
Threshold Bit Score: 237.733
Threshold Setting Gi: 21227081
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499328451  38 VQACYQCGTCTGSCPSGRRTSYRTRLIMRKLQLGLVDEVIKSDELWMCTTCYTCYERCPRGVKIVDAVKAARNLAAKKGY 117
gi 41017066   32 LEYCFQCGTCTGSCPSGRRTPYRVRQIIRKANVGLKDEIISDPALWMCTTCYSCQERCPRKVKIVDVVKLARNEAAKAGF 111
gi 499725867  32 LAICYQCGTCSGACPSGRRTPYMIRRLVRKALAGLKDQVISDDAIWMCTTCYECQERCPRDIKIVEIVKAIRNVAAHEGY 111
gi 499172662  32 FKACYQCGTCTGSCPSGRITAFRTRKLIRYAQFGMKSAIIDSEDLWMCTTCYECYERCPRTVKITDIIKVLRNIAAREGK 111
gi 499172792  33 IKACYQCGTCTGSCPSGRRTAYRTRKVLRKVLLGL-DDVLDSDDIWYCTTCYTCYERCPRDVKITEIIKTLRNIAAQKGN 111
gi 499768086  41 ANMCYQCGTCTGSCPSAPRSSYRIRLFMRRCVLGLENEALTDPDLWLCTTCYSCTDRCPRDIAPTDVIMAMRNLAFKRDI 120
gi 499343390  16 VLSCMHCGTCTGSCPSGRHTGLNTRRIIRDARKN-RATVLSDDALWLCTTCYTCQERCPRGIPITDALLELRRLAVRKGF 94
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 499328451 118 MAKAHRMVAMFVIKTGHAVPINDEIREVRKNIGLDEVPPTTHRYEEALEEVQKLVKINEFDKLI 181
gi 41017066  112 MAPAHKAVGSFVIKTGHGVPINDATMELRKAVGLGELPPTTHQFPEALEEVQKIIKATGFDQLI 175
gi 499725867 112 MALSHKKTGSFVAKTGHAVPINDKVKTLRKEIGLDEVPATTHKFPEALEEVQTLIKATGFDELI 175
gi 499172662 112 MAEAHKKTALYVFKTGHAVPINDQIKKARKEIGLTEIPPTTHKYPDALEVVRGIMKDLRFCDMV 175
gi 499172792 112 MALAHRKTASYVLRFGHAVPANNQIVELRGKLGLPAKSPTAQFSEKDLEEVRTLIKELKFDKLI 175
gi 499768086 121 VPKNFLQTVQLIYNSGHGVPNNDVNRAARTKLGLPADPPTTHSYPEFVKGIQKIIDHYELKENA 184
gi 499343390  95 MRPEHRRVSELVLECGHAVPLDEETKKKREELGLDPIPETVQKYPEALEELKALLKTCKFDELA 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap