Conserved Protein Domain Family
alt_F1F0_F1_bet

?
TIGR03305: alt_F1F0_F1_bet 
alternate F1F0 ATPase, F1 subunit beta
A small number of taxonomically diverse prokaryotic species have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F1 beta subunit of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132348
View PSSM: TIGR03305
Aligned: 5 rows
Threshold Bit Score: 901.114
Threshold Setting Gi: 32473392
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499627299  11 GKVISVRGSIVDVLFERHLPPVYTLLRAGrlragrESQIAIEVLTQLDAHHVRGIALTPTEGLARGMAVEDTGGPLKAPV 90
gi 499894709  21 GLVAAVRGSIVDLIFEQHVPPIHNVLYAQ------NKHVVLEVVAQLSAQKIRTIALTATQGLARGMPVEDSGGPLKVPV 94
gi 499235171  10 GIVTSIRGSVVDMRFDELLPSIYSVVKTGr-----EMEVTVEILMQLDRRHVRGIALTPTEGLCRGMKARNTGSPLKAPV 84
gi 499662043   9 GTVVAVRGGIVDARFDGEMPALHSLLLAGa-----QDEIVVEVMLHLDGGHVRGNALTPTQGLACGDTIKDSGAPLQAPV 83
gi 499432701  58 GHVVAVRGSVIDVHFPGEPPAMNCELRIGd-----SGDVVAEVASQLDPHTVRAIAITSPRGLSRGTPVRSCGRSMQVPV 132
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499627299  91 GREILSRMFDVFGNTIDRRKPPSDIQWRSIHQAPPPLMRRSTTSEIFETGIKAIDVLVPLERGGKAGLFGGAGVGKTVLL 170
gi 499894709  95 GPSTLSRMFNVFGAPIDGHTYQHDGKWRSVHQAPPALTKISSQLQIFETGIKIVDVLCPLERGGKAGLFGGAGVGKTVLL 174
gi 499235171  85 GKGTLSRMFDVFGNAIDRRGPVTNVTWRSVHGAPPQLSRRSTKSEVFETGIKIIDLLVPLERGGKAGLFGGAGVGKTVLL 164
gi 499662043  84 GQAILGRVFNVFGQPIDRREPPDGCRWRSVLTKPAGLTERSSKTEMFITGIKAIDVLAPLERGGKAGLFGGAGVGKTVLI 163
gi 499432701 133 GKPLLGRVLDVFGNTLDDGESLKSVEHRSIHQTPPTINRRIAKSEVFTTGIKAIDLLSPLERGGKAGLFGGAGVGKTVLI 212
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499627299 171 TEMIHNVVKQHQGVSIFCGIGERCREGEELYRDMKDAGVLPHTVMVFGQMNEPPGARFRVGHTALTMAEYFRDDERRDVL 250
gi 499894709 175 SEMIHNMVSQQQGVSIFCGIGERCREGEELYREMKEAGVLDNMVMLFGQMNEPPGSRFRIGHAALTMAEYFRDDEKKDVL 254
gi 499235171 165 TEMIHNMVSKESGVSIFCGIGERCREGEELYRDMSEAGVLDNMVMVFGQMNEPPGSRFRVGLTALTMAEYFRDDLHQEVL 244
gi 499662043 164 TELIHNMVGQHEGVSLFCGIGERCREGEELFREMREAGVLDNTVMVFGQMNEPPGARFRVGLTALTMAEYFRDDQGRDVL 243
gi 499432701 213 TELIHNIVGGHDGISLFCGIGERCREAEELYREMGAAGVRDNTVMVFGQMNEPPGARFRVGHAALTMAESFRDDAKQDVL 292
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499627299 251 LLIDNIFRFIQAGSEVSGLMGQMPSRLGYQPTLGTELSELEERISTTDAGAIMSIQAVYVPADDFTDPSAVHTFSHLSAS 330
gi 499894709 255 LLIDNIFRFIQAGSEVSGLMGQMPSRMGYQPTLGTELAGLEERIANTEDGAVTSIQAVYVPADDFTDPAAVHTFSHLSAT 334
gi 499235171 245 LLIDNIFRFIQAGSEISGMIGQMPSRLGYQPTIGTELSALEERIANTGTGAITSIQAVYVPADDFTDPAAVHTFSHLSAS 324
gi 499662043 244 LLIDNIFRFIQAGMEISGLLGLMPSRLGYQPTMGTELAELQERISSTRHAAITSIQAVYVPADDFTDPAAVHTFSHLSAS 323
gi 499432701 293 LLIDNIFRFVQAGMEVSGLLGQLPSRVGYQPSLASDLAELEERICTTSDAAITSVQAVYVPADDFTDPSAVHTFAHLSAT 372
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499627299 331 IVLSRKRASEGLYPAIDPLQSNSKMATPGIIGERHYHLAQKIRQTLAQYSELKDIISMLGLEQLSPEDRNVVARARRLER 410
gi 499894709 335 LVLSRKRASEGFYPAVDPLQSSSKLATPTVVGQRHYDVARQVKQILAQYNELKDIIAMLGLEQLSKKDRDVVSRARRLER 414
gi 499235171 325 LVLSRKRAGEGFYPAVDPLSSGSKMAGESIVGRRHYDLAREVRRVLAQYAELKDIIAMLGLEQLSAEDRRLVGRARRLER 404
gi 499662043 324 IVLSRRRASEGLYPAIDPLASTSNILNPRIVGERHYRLAQEIRRTLATYEELKDIIAMLGLEELSREDRRIVFRARRLER 403
gi 499432701 373 VVLSRKRASEGLYPAIDPLKSTSEMMLPGVVGDRHYKTASNVRQTLAGYEELKDIIAMLGMEELSRQDRLTVNRARRLER 452
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....
gi 499627299 411 FLTQPFFTTEQFTGIKGKTVSLSDALDGCDRILHDEFKDYSEGDLYMIGTIDEA 464
gi 499894709 415 FFTQPFFTTEQFTSMKGKFVSLEQALTGCERILQGEFDDYPESALYMIGEIDEA 468
gi 499235171 405 FFTQPFFTTEQFSGLAGKSVPIANTIDGCERILRDEFENYPERALYMIGSIAEA 458
gi 499662043 404 FLTQPFHTTQQFTGMQGRTVALDAALNGCEAILNDEFSEAPEKILYMIGGLEEA 457
gi 499432701 453 FLTQPFFTTQQFTGHEGHMVSIEDTLDGCERILNDEFQDRPERDLYMVGKIPSS 506
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap