Conserved Protein Domain Family
phn_thr-fam

?
TIGR03308: phn_thr-fam 
phosphonate metabolim protein, transferase hexapeptide repeat family
This family of proteins contains copies of the Bacterial transferase hexapeptide repeat family (pfam00132) and is only found in operons encoding the phosphonate C-P lyase system (GenProp0232). Many C-P lyase operons, however, lack a homolog of this protein.
Statistics
?
PSSM-Id: 132351
View PSSM: TIGR03308
Aligned: 6 rows
Threshold Bit Score: 346.375
Threshold Setting Gi: 110668502
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499823469  41 VAKMLSVEPTVDPTAQLHEVKLGAYCEVGARTILHEVAMDDYSYVVNDAQITYSTIGKFCSIAAMTRINPGNHPMQRVTQ 120
gi 499273312   1 MSVKVGLEPVIHESARVTNSSIGRYTEISERCRLEEVEMGDYSYVMQDGAIWCATIGKFVNIAASVRINATNHPMQRATL 80
gi 499781737  13 PPASLGLAPTLSASAIVRDCRFGRYTQVGEQTRMGDCLLDDYAYVQHNCDLMSTDIGKFANIANMVRINPGFHPMERPTL 92
gi 499856576   1 MPKLSASDPYAHPGCSLTNSTFGAWVEIGANTRVANSAFGDYSYCDRMCDIANAQIGKFANIASCVRIGATDHPMEKASL 80
gi 499212694   6 NLVLKDPEPRIHPTAELKACKLGRYALIGERVVLREVSVGDFSYFERHSEAIYTTIGKFCSIAANSRINALEHPIERLTQ 85
gi 499891089  10 RIDSLSPEPTLHDPVHITESNLGRWTDVRSYARVSESTLDDYSYLMERVQLDYTSVGKFVSVASDARLGPTNHPITRPTA 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499823469 121 AHFTYRASAYFEGESDDAEFFAWRRAHHVHIGHDVWIGHGAIVLPGRNIGTGAVVAAGAIVTRDVPAYTIVAGNPARLIK 200
gi 499273312  81 HHFTYRARSYWDDAEDETDFFAARRAKRVVIGHDVWIGHGATILPGITVGNGAVIGAGAVVSKDVAPYTIVGGVPARLIR 160
gi 499781737  93 HHFTYRPTMYGMDTQDDADFFAWRLRQRVVIGHDTWIGHGAVIMPGVHIGNGAVVGSNSVVTRDVASYAIVAGAPATVIR 172
gi 499856576  81 HHFLYRSASYWEDAEDDADWFAHRKSRRAEIGHDTWIGHGALIKPEVTIGHGAVVAAGTVVTKDVAPYTIVGGNTAKLIR 160
gi 499212694  86 HKVSYRPNEYFRWLGVDAAFRERRQAKAVTIGHDVWIGHGAVIMPGITIGNGAVIGANAVVTQDVPSYTIVAGVPAKPLR 165
gi 499891089  90 HHFSYRAAMY-DLGSDDETVFEWRSDHPVTIGHDVWIGHGATILPGVEIGNGAVIAAGSVVTDDVSPYTVVAGVPASVIR 168
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 499823469 201 RRFPEFVANRLADLTWWDWDHEALRKALPDFRRLPVEEFLDKYE 244
gi 499273312 161 ERFPAELGKRMDDLNWWDWDHARLRSALEDFRALDAEDFVAKYG 204
gi 499781737 173 QRFPRAIAQALEATAWWDWDHDTLTERMPDFKDMRC--FLAKYA 214
gi 499856576 161 RRYTEPVAERMIALAWWDWDHATLRAALADFRALPAEAFLEKYE 204
gi 499212694 166 PRFAPDIAARIEALAWWDWPVEKLARAVPDIQSMPIEAFLDRWE 209
gi 499891089 169 RRFAPEIAARIESTEWWHWSHETLSERIAAFRDL--EMFLDMYA 210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap