Conserved Protein Domain Family
matur_yqeB

?
TIGR03309: matur_yqeB 
selenium-dependent molybdenum hydroxylase system protein, YqeB family
Members of this protein family are probable accessory proteins for the biosynthesis of enzymes with labile selenium-containing centers, different from selenocysteine-containing proteins.
Statistics
?
PSSM-Id: 132352
View PSSM: TIGR03309
Aligned: 9 rows
Threshold Bit Score: 398.226
Threshold Setting Gi: 55376796
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499422092   1 MIVRGGGDLATGVIQKLWHVGFK-ILVLETECPLAIRRTVSVCDAIFQKEQRVEDLVAVRITSLKDCAKCWQQNKLPVFV 79
gi 640494424  12 VIVRGGGDLASGTIHKLHRSGFK-ILVLETYYPTSIRRNVCYSEAIYTGKITIENTTAIRVSNFNEILKCWQNNEIPITV 90
gi 446943101 271 VVIRGAGDIASGVALRLYHAGFK-VIMLEVEKPTVIRCTVAFAQAVFDGEMTVEGVTARLATSSAEAMKLTERGFIPVMV 349
gi 499537904 271 VLIRGAGDIATGVAVRLHNSGFK-VVMTDIAQPTVIRCTVSFAQCLYGDPVEVEGITAQKARSCEEVFTVLEQGNIPVMV 349
gi 499712764   6 VVIKGAGDLASGVAHRLHQSGFQ-VIMTEIPRPTVIRRAVAFAEAVYSGEITVEGVTARLVSDPEGALRVTWQGEVAVLV 84
gi 499662890 175 VVVKGAGDIATGIIWRLHQAGFK-VVATELSKPTAIRRMVAFAQAIYTGEHTVEGITARR-SNLFEVPNLLVNDFIPVIP 252
gi 499778654   7 VVIKGAGDIATGVGRRLFRCGFP-LVMTEQLQPTPVRRTVAFAEAVYKGETTVEGVTARLIEDPAHVYSTLREGHIPIIP 85
gi 490648072   9 IIMKGAGEMATGVACRLHRSGFRrILMLEAPSPLAVRRGVSFCEAIHNGRKSVEGIEAVRIENGSALADAWGKGEIPLLA 88
gi 494350157 268 VVVRGGGDLGSGVVYRLQQAGFP-VIVTEVDQPTVVRRAVAFGAALYEDEVEVEGVTGRAAADIDEALELLADDVVPVLV 346
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499422092  80 DQTASAIQQLKPLIVIDAILAKKNL--GTHRGMAPITIALGPGFSAPQDVDVVIETMRGHRLGRLYFEGTALPNTGIPGE 157
gi 640494424  91 DPRGKFIEMLKPRILIDAILAKKNL--GTRINMAEITIGLGPGFEAGKDVHAVIETMRGHNLGRVILKGEAIKNTGIPGE 168
gi 446943101 350 DPACSLLDELKPLCVVDAILAKQNL--GTRADMAPVTIALGPGFAAGKDCHAVIETNRGHWLGQVIYCGCAQENTGVPGN 427
gi 499537904 350 DQECCSLNNLKPTFVVDAILAKRNL--GTTKDMAPVTVALGPGFNAGVDCDAVIETNRGHYLGRVIYHGETQANTGIPGN 427
gi 499712764  85 DPRAEVIAALKPRVVVDAILAKTNL--GTRIDQAPIVIALGPGFTAGTDAHAVIETQRGHYLGRVIWQGAAAANTGIPGE 162
gi 499662890 253 DEEGIVVKELKPWAVVDARLAKKNL--GTKKEEAEIVIGVGPGFTAPEEVHAVIETKRGHYLGRAIYQGSALPNTGIPGE 330
gi 499778654  86 DPEAHIIRVLNPKVVVDAILAKKNL--GTAKSNAPIVIGLGPGFTAGKDVHAVIETNRGHNLGRVILNGSAEPNTGVPGV 163
gi 490648072  89 DPQGDAVRRMEPDILIDATIAKRNL--GIAITDAPLVIALGPGFFAGRDCHLVIETNRGHNLGRLIACGEAEPNTGIPGN 166
gi 494350157 347 DPEATVADDLDAAVLVDAIMAKGAFdtGTRREDADVVVGMGPGFEAGEDVDAVVETDRGHELGRVFYDGTASEYDGEPGE 426
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499422092 158 IGGKSAERVVHAPASGQVTHLKNIGDLVLKGEALFLIDQVPVYSPLTGTLRGLISEKVTCYQGLKCADVDPRPvEKVDCL 237
gi 640494424 169 IGGYSKERVIYSPAKGTIQNVKEIGDFVSSGEILAYVDNIEIKTKISGLLRGLIRNGSIIEKGLKIADVDPRCyEMQNCY 248
gi 446943101 428 IMGHTTRRVIRAPAAGIMRSNVKLGDLVKEGDVIAWIGEHEIKAPLTGMVRGLLNDGLAVVGGFKIGDIDPRG-ETADFT 506
gi 499537904 428 IAGYTHQRVLRAPCNGIMHNHVSLGDIVEEGDVIAHVADSPVVSPLSGMVRGLLNEGLTVTEGFKIGDIDPRG-IEADFT 506
gi 499712764 163 VMGYREERVLRAPVAGIFKSCKAIGDSVKAGETVATVNDVPLRAQIGGVLRGVLHDGLEVTAGQKAGDVDPRG-ERDYCF 241
gi 499662890 331 IGGHTVKRVVYSPGRGKVCWYFDFGQEVKAGEVIGTVGEKQIVAAVSGVIRGLIHPEVWVEEGMKIGDIDPRG-IKEYAF 409
gi 499778654 164 VNGYGSERVLRSPADGAIVPIREIGDFLLKGDVIAVVEGEPVVAPFDGTLRGLVHEKVTVFKGMKIGDVDPRA-SREHCY 242
gi 490648072 167 IGGYTRERVLRAPADGHFTTEKVIGDQVSKGDVVGIVGTNTVTASIDGILRGLIRPGTHVTTGLKIGDIDPRG-DTAYCH 245
gi 494350157 427 RRGYTHERVLRAPTDGEWTPTVAIGDSVTAGDVVGTVGDRPVETEIDGLVRGLVHGGLSVSEGTKLGDVDPRG-ESVDPT 505
                        250       260
                 ....*....|....*....|
gi 499422092 238 TISDKARALGGAVLEAIFMI 257
gi 640494424 249 TISDKARNIAGGVLEAILYF 268
gi 446943101 507 SVSDKARAIGGGVLEALMML 526
gi 499537904 507 TVSDKARAIGGSVLEAMLHL 526
gi 499712764 242 TISDKARAIGGGVLEAILHL 261
gi 499662890 410 TISEKALAIAGGVLEVLLKL 429
gi 499778654 243 TISDKALAISGGVLEAILSH 262
gi 490648072 246 TISEKARALGGSVLEAILTV 265
gi 494350157 506 KISDKALCLGGGVLEAVLRL 525
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap