Conserved Protein Domain Family
Se_sel_red_FAD

?
TIGR03312: Se_sel_red_FAD 
probable selenate reductase, FAD-binding subunit
This protein is suggested by Bebien, et al., to be the FAD-binding subunit of a molydbopterin-containing selenate reductase. Our comparative genomics suggests it to be a subunit of a selenium-dependent molybdenum hydroxylase for an unknown substrate.
Statistics
?
PSSM-Id: 132355
View PSSM: TIGR03312
Aligned: 3 rows
Threshold Bit Score: 412.368
Threshold Setting Gi: 117620500
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499537858   2 IEHYLQPESTIQALELMKQHTGVAAWFAGGTKLNATPTKTDKTVAISLDKLALDKIELQGEALHIGAMCHIQSLIDNELT 81
gi 446494608   2 IEQFFRPDSVEQALELKRRYQDEAVWFAGGSKLNATPTRTDKKIAISLQDLELDWVDWDNGALRIGAMSRLQPLRDARFI 81
gi 500025311   2 IEQFFRPEQLGQALELKARFGNDAVYMGGGSKLNAAPTRTDKKVAISLDKLGLGQIEQQHGQLHIGATVTLQALKDDPRT 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499537858  82 PVALKQAAAFIYSRHIRNQATIGGEIAAFQSEALLVPSLMALKATVILANASQMDIEDYINSEQRELIVEVIIPNVNLMC 161
gi 446494608  82 PAALREALGFVYSRHVRNQSTIGGEIAARQEESVLLPVLLALDAELVFGNGETLSIEDYLACPCDRLLTEIIIKDPYRTC 161
gi 500025311  82 PAALCEALGFVYSRHLRNQATLGGEIACQQQDSPLLPVLLVLEAVVVLENNQLQPIDAYLAGQRKELVLGVVLPEPELRC 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499537858 162 IGYNITRSAAGLAVVTAAVSVDQKGNKIIALDGVSPfhhgyaVPVRLRDIEAQDLKGELLEQAVADAVHPVANLCGSIEY 241
gi 446494608 162 ATRKISRSQAGLTVVTAAVAMTDHDGMRIALDGVAS------KALRLHDVEKQNLEGNALEQAVANAIFPQEDLRGSVAY 235
gi 500025311 162 ATRRISRNADGLAVMTAAVALDALGEMRVALAGVTP------QPMRLRDVERHELRDAALEAAVSALIAPRADLGGSVAY 235
                        250       260
                 ....*....|....*....|...
gi 499537858 242 KRYIAGVVVTDLLAECQHLAQEA 264
gi 446494608 236 KRYITGVLVADLYADCQQAGEEA 258
gi 500025311 236 KRYISGVVVADLLVECQQQEVQA 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap