Conserved Protein Domain Family
Se_sel_red_Mo

?
TIGR03313: Se_sel_red_Mo 
probable selenate reductase, molybdenum-binding subunit
Our comparative genomics suggests this protein family to be a subunit of a selenium-dependent molybdenum hydroxylase, although the substrate is not specified. This protein is suggested by Bebien, et al., to be the molybdenum-binding subunit of a molydbopterin-containing selenate reductase. Xi, et al, however, show that mutation of this gene in E. coli conferred sensitivity to adenine, suggesting a defect in purine interconversion. This finding, plus homology of nearby genes in a 23-gene purine catabolism region in E. coli to xanthine dehydrogase subunits suggests xanthine dehydrogenase activity.
Statistics
?
PSSM-Id: 132356
View PSSM: TIGR03313
Aligned: 3 rows
Threshold Bit Score: 2064.57
Threshold Setting Gi: 229576673
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312   5 FTLNGALRTVITPAGENAQRVLFNQcRMHSVRNSDDGFGFAGSDAILFNGKVINASLLIAAQLEGAQVRTAESLGSWNQL 84
gi 499537857   5 FTLNGRPQTLECKLGENVQTLLHGM-GYHSVRNSDDGFGFAGSDVILLNGVLKNASLLVAAQLEGKEVQTAESLGQWNQL 83
gi 446505781   5 FTLNGAPQELTVNPGENVQKLLFNM-GMHSVRNSDDGFGFAGSDAIIFNGNIVNASLLIAAQLEKADIRTAESLGKWNEL 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312  85 SLVQQAMVDVGVVQSGYNDPAAALIVTDLLDRHPNPSRDQIDDALSGLFHRDGGYQQFYQAIELASSRLKDPDYLCQIAP 164
gi 499537857  84 SLVQQAMIDVGVVQSGYNDPALALILTQLLETNTQPNRAEIDDALSGLFSRDAGYQQFYEVVELAVKRLKDPEHKQSFAP 163
gi 446505781  84 SLVQQAMVDVGVVQSGYNDPAAALIITDLLDRIAAPTREEIDDALSGLFSRDAGWQQYYQVIELAVARKNNPQATIDIAP 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312 165 EFRGDLRHIGKSCPKVDAAKMVQAKPCYVEDRVSEDALVIKMLRSPHPHAVITKLDVSRAEAMPGVVHVITHLNCPDVYY 244
gi 499537857 164 EFRDDLTIVGKNCPKIDSAKMVQAKPCYVEDRIPANACVVKVLRSPHPHAWITHLDVSKAEALPGVVSVITHLNCPDIPY 243
gi 446505781 164 TFRDDLEVIGKHYPKTDAAKMVQAKPCYVEDRVTADACVIKMLRSPHAHALITHLDVSKAEALPGVVHVITHLNCPDIYY 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312 245 TPGGQSAPEPSPLDRRMFGRKLRHVGDRVAAVVAESEAIALAALKLIEVEYQVLPAVMNIDEAMAPNAPLVHDEPIVYMA 324
gi 499537857 244 TPGGQSAPEPSPLDRRMFGQKMRHVGDRVAAVVAESLEIAEHALTLIDVEFDVLTPVMSIDEARAAEAPIIHNEPIEYGV 323
gi 446505781 244 TPGGQSAPEPSPLDRRMFGKKMRHVGDRVAAVVAESEEIALEALKLIEVEYEVLKPVMSIDEAMAEDAPVVHDEPVVYVA 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312 325 GAPADLEQQNACSVRRGdEHMIINFPIGSRPHENLAASVHGQIGDVAKGFAEADEIVERTYESTQAQQCPTEPHICFTYM 404
gi 499537857 324 GAPDDLEEQNANADPRE-GKLIVNFPIGCYPRKNIAASVRGHIGDLNKGFEEADVIIERTYESKQVQQLPVETHICYSYM 402
gi 446505781 324 GAPDTLEDDNSHAAQRG-EHMIINFPIGSRPRKNIAASIHGHIGDMDKGFADADVIIERTYNSTQAQQCPTETHICFTRM 402
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312 405 DGERLVIHASTQVPWHVRRQVARIVGMKQHQVHVIKERVGGGFGSKQDILLEEVCAWATKVTGRPVTFRYTREEEFISNT 484
gi 499537857 403 DGERLVMHDSTQVPWHVRRQVAKILGIKQNKVHIVKERVGGGYGSKQDILLEDVCAWATWTTGRPVYFHHTREEEFICNS 482
gi 446505781 403 DGDRLVIHASTQVPWHLRRQVARLVDMKQHKVHVIKERVGGGFGSKQDILLEEVCAWATCVTGRPVLFRYTREEEFIANT 482
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312 485 SRHVAKVKVKVGAKKDGTITAIEMDFRANTGPYGNHSLTVPSNGPALSLPLYPCENVRFTVNTYYSNICPTGAYQGYGAP 564
gi 499537857 483 TRHVAKVTVKLGATKDGKLTAIDMEFRANTGPYGNHALTVPSNGPALSLPLYPCDNVDFRVTTYYSNICPTGAYQGYGAP 562
gi 446505781 483 SRHVAKVTVKLGAKKDGRLTAVKMDFRANTGPYGNHSLTVPCNGPALSLPLYPCDNVDFQVTTYYSNICPNGAYQGYGAP 562
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312 565 KGNFALTMAIAELAEKLGIDQLEMVEHNRVHEGDILKVLGAIGEGKMPTSVPHAASCALEPILKQGRELIAWDSPKAADG 644
gi 499537857 563 KGNFALTMAMAELAEELGIDHLDMIETNRVVEGQELKILAAIGEGKMPTSAPKVHSCALKEILREGRKLIEWDSAKQAKG 642
gi 446505781 563 KGNFAITMALAELAEQLQIDQLEIIERNRVHEGQELKILGAIGEGKAPTSVPSAASCALEEILRQGREMIQWSSPKPQNG 642
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312 645 DWRIGRGVAIIMQKSGIPDIDQANCMVKLESDGTFIVHSGGADIGTGLDTVVAKLTAEVLHCPLGDVHVISGDTDHALFD 724
gi 499537857 643 DWKVGRGAAIIQQKSGIPDIDQANCSIKMASDGTFIVHSGGADIGTGLDTVVSKLTAEVLRCPMDEITIHSGDTDHAPFD 722
gi 446505781 643 DWHIGRGVAIIMQKSGIPDIDQANCMIKLESDGTFIVHSGGADIGTGLDTVVTKLAAEVLHCPPQDVHVISGDTDHALFD 722
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312 725 KGAYASSGTCFSGNAAKKAAENLKEKILFHGAAMLGEPVADVELAFPGLVRGKLGEVSLAKLAHKAETGTGFGILVGTAS 804
gi 499537857 723 KGAYASSGTCFSGNAAKRAAEAMREKILKCGAEMLAEPVEDVDVVAPGLVKGKTGEVSYFDIAHKAESGTGWGQLLATGC 802
gi 446505781 723 KGAYASSGTCFSGNAARLAAENLREKILFHGAQMLGEPVADVQLATPGVVRGKKGEVSFGDIAHKGETGTGFGSLVGTGS 802
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500025312 805 YITSELAFPYGANFAEVAVNVRTGQIRLDKFYALLDCGTPINPELALGQIYGATMRAIGHSLTEEICYDGKGIPLTRDLK 884
gi 499537857 803 FTTSEFAFPYGANFAEVSVNTRTGEIKLDKFHALLDCGTPVNPDLALGQIYGASMRAIGHSMTEELVYDDNGIPLTRDLK 882
gi 446505781 803 YITPDFAFPYGANFAEVAVNTRTGEIRLDKFYALLDCGTPVNPELALGQIYGATLRAIGHSMSEEIIYDAEGHPLTRDLR 882
                        890       900       910       920       930       940       950
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 500025312 885 SYGAPKIGDIPRDFRAFLVPSDDKVGPYGAKSISEIGVNGAAPAIATAIHDACGVWLRKWHFTPEQILRELGK 957
gi 499537857 883 SYGAPMIGDIPTEFKAVLVPSDDPVGPYGAKSISEIGVNGAAPAIASAIHDACGVWLRDWHFTPEKVLKGLNK 955
gi 446505781 883 SYGAPKIGDIPRDFRAVLVPSDDKVGPFGAKSISEIGVNGAAPAIATAIHDACGIWLREWHFTPEKILTALEK 955
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap