Conserved Protein Domain Family
Se_ssnA

?
TIGR03314: Se_ssnA 
putative selenium metabolism protein SsnA
Members of this protein family are found exclusively in genomes that contain putative set of labile selenium-dependent enzyme accessory proteins as well as homologs of a labile selenium-dependent purine hydroxylase. A mutant in this gene in Escherichia coli had improved stationary phase viability. The function is unknown.
Statistics
?
PSSM-Id: 132357
View PSSM: TIGR03314
Aligned: 6 rows
Threshold Bit Score: 733.507
Threshold Setting Gi: 54309128
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500994472   2 LLIGNGKVITRDNTRPIIDNGCIAVDENKIIEIGSTETLKNKYKESQFIDAKGKLIMPGFINTHMHYYSTFARGMANDSP 81
gi 488288417   2 LLIGNGRLITRDAQNHFFENGCVAIDGQVVKQVGTTEELKQAYPEATFIDAKGGVIMPGFINMHNHIYSTFARGLSLTNY 81
gi 12517403   24 LILKNVTAVQLHPAK-VQEGVDIAIENDVIVAIGDA--LTQRYPDASYKEMHGRIVMPGIVCSHNHFYSGLSRGIMANIA 100
gi 500025310   2 FILKNVTAVQLEPTR-VLEGVDIAIEGSLIKAVGPN--LRALYPEATYREMGGKLVMPGIVCAHNHFYSGLSRGIMANIA 78
gi 499712721   2 LLIGNGRLLSLVPGKPYQEDGAVAIDGDLIVAVGPTAELKARYPAAEWLDARGMVIMPGMINTHMHLYSTFARGMALKDP 81
gi 499537866   2 LLLKNATAVQFEPAF-IKEGVDIAIDGSTIKEVGAN--LSMKYPDAIVKEMHGKLVMPGLVCSHNHFYSGLARGVMADIK 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500994472  82 PAKSLCDILTGLWWRLDKVLTLEDVYYSAAVPMIDQIKNGVTTVFDHHASTHAVKGSLFKIAEAAETMGIRSNLCYETSD 161
gi 488288417  82 HPKNFMDILVDQWWRIDRALTLEDTYQSGKVAYLDSIRNGVTTVFDHHASYGEITGSLTQLSNAADELGIRTCLCYEVSD 161
gi 12517403  101 PSPDFISTLKNLWWRLDRALDEESLYYSGLICSLEAIKSGCTSVIDHHASPAYIGGSLSTLRDAFLKVGLRAMTCFETTD 180
gi 500025310  79 PCPDFISTLKNLWWRLDRALDEESLYYSGLICSLEAIKSGCSAVIDHHASPNFIKGSLNVLRKGFVEAGLRGMTCFETTD 158
gi 499712721  82 PPTNFLEILQRLWWRLDKALTLEDVYYSALLPLIDCIKSGTTTILDHHASPYAVTGSLEMIARAAMETGVRTCLAYEVSD 161
gi 499537866  79 PSPDFISILKNLWWRMDRALDEEAVYYSGLICSLEAIKSGCTSVIDHHASPNYIGGSLSTIRKGFIKAGLRGMTCFETTD 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500994472 162 RDGE-KIAQEGINENVEFIK-----HCNAKNDDMIKGMFGLHASMTISDKTLEKCVdAVKGLNTGFHVHCGEGIEDLEDS 235
gi 488288417 162 RDGE-QKMREAVQENAAFIK-----ASSLRNDDMQKAMMGMHAAFTLSDASLELCA-ANTPDGIGYHIHIAEDLADVHDS 234
gi 12517403  181 RNNGiKELQEGVEENIRFARqideaKKAATEPYLVEAHIGAHAPFTVPDAGLEMLReAVNATGRGLHIHAAEDLYDVSYS 260
gi 500025310 159 RNGGlAELQAGVEENILFAQaidaaKAKGSEPYLVEAHIGAHAPFTVPDEGLAMLReAVQVTGRGLHIHVAEDRYDMAHG 238
gi 499712721 162 RDGK-EIMRQGIAENIAAIK-----KYRGKEG-LISATFGLHASLTLSDATLEACReAEGEVGSGFHIHVAEGIQDVEDA 234
gi 499537866 159 RNGGmKEMMAGVEENIAFAQlidraKEEGTEPYLVEAHIGAHAPFTVTNDGLAMMAeAVQATGRGIHVHVAEDRYDVTHS 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500994472 236 KKKYGKGIIERWNNAGVLCDKTIAVHCIYVSDEEMDMLKEKNTIVVHNPESNMGNAVGVSPVLKMYKK-GILLGLGTDGY 314
gi 488288417 235 LKKYGKPIVNRLFDLGILGKQTMAGHCIHIGPHEMELLRDTDTMVVTNPESNMGNAVGCPPAMRMFNEyGILMGLGTDGY 314
gi 12517403  261 HHWYGKDLLARLAQFDLIDSKTLVAHGLYLSKDDIALLNQRDAFLVHNARSNMNNHVGYNHHLSDIRN----LALGTDGI 336
gi 500025310 239 HHHHGKEPIARLDEFGLVDSKTLIAHGIYLSPADIELLNSRDAFLVHNARSNMNNHVGYNLHLPEYRN----LALGTDGI 314
gi 499712721 235 LAKSGKRVVERLAVNGILGPNTIAAHCVHVTDREIAILKETGTLVVHNPESNMGNAVGCAPVGDMLAA-GVPVGLGTDGY 313
gi 499537866 239 HHHYGQDIVERLDSFGLINEKTLLAHGLFLSDRDIDILNAKDGFLVHNARSNMNNNVGYNNKLIRFKN----VALGTDGI 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500994472 315 TPDIIESYKVANIIHKHATSDSTVAWTEIPEMLFENNGKITERFIDGKIGVLKEGALADIIVVDYNPPTPINENNINSHI 394
gi 488288417 315 TNDVTESYKVGNVIHKHHLADPNAAWAEIPTMLFDNNPQMANRYFKTKLGVLEPNAAADVIIVDYHGPTPMTKENYNMHI 394
gi 12517403  337 GSDMFEEMKFAFFKHRDAGGPL---WPDSFAKALTNGNELMSRNFGAKFGLLEAGYKADLTICDYNSPTPLLADNIAGHI 413
gi 500025310 315 GSDMLEELKFAYFKHKDAGGAL---WPDSFARFLWNGNTLLERNFGAKFGRLEPGYKADLTICDYAAPTPLAPRNLGGHL 391
gi 499712721 314 TSDMFESLKTANVLRKFVSGDPGAGWAEVPAMAFENNRRIASRFFPHPLGRLEPGAYADVILVDYQAPTPLGRDNWFGHL 393
gi 499537866 315 GADMFEELKFSFFKHRDAGGPL---WPDSFMKNLWNGNEILARNFGAKFGRLDAGNKADLTILDYTSPTPFVADNLAGHV 391
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*...
gi 500994472 395 LFGINGRHVDTTIINGKVLMEDRKLLHVDEERVMARSRELAKEVWKRF 442
gi 488288417 395 LFGMNGGMVTDTVINGEIRMRNREVQGIDEEKVWHDAQTQAQSFWKRV 442
gi 12517403  414 AFGMGSGSVHSVMVNGVMVYEDRQF-NFDCDSIYAQARKAAASMWRRM 460
gi 500025310 392 AFGMGSSSVNSVMVEGRMVYQDREF-AFDVAPLYEQASKVASRLWQRM 438
gi 499712721 394 LFGFNGGLVDTTVVGGKVLMQRQRLLHLDEAAIAARARELAIKVWERF 441
gi 499537866 392 AFGMNAGNVNSVMVEGRFVYEDRAF-PFDIAPIYAEASKVAERLWKTM 438
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap