Conserved Protein Domain Family
YdfZ_fam

?
TIGR03318: YdfZ_fam 
putative selenium-binding protein YdfZ
This small protein has a very limited distribution, being found so far only among some gamma-Proteobacteria. The member from Escherichia coli was shown to bind selenium in the absence of a working SelD-dependent selenium incorporation system. Note that while the E. coli member contains a single Cys residue, a likely selenium binding site, some other members of this protein family contain two Cys residues or none. [Unknown function, General]
Statistics
?
PSSM-Id: 132361
View PSSM: TIGR03318
Aligned: 5 rows
Threshold Bit Score: 114.54
Threshold Setting Gi: 51596742
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 446136857  1 MTTYDRNRNAITTGSRVMVSGTGHTGKILSIDTEGLTAEQIRRGKTVVVEGCEEKLAPLDLIRLG 65
gi 500023516  1 MKIYDRNRNALTPGQRVMIAATGAVDFLKEAHTDNLTPYQAEHEKCVLLANSREQYAPIELIRLG 65
gi 259039786 12 MKTYDRNRNAIATGSMVMIAGNGTTGVIKAIHGEGKTAEQLRRADCVEIDGCEGRFCPLDLIRLG 76
gi 501166034 22 MMTYDRNRNAITTGSRVMISGTGHTGIIKAIESEGLDAGQIRRGKTVIVEGCEGKFAPVELIRLG 86
gi 488139694  2 VKVYDRNRNQIVPGQRVMIAQSGVIDVAKAIHADGMSAVQAEREKVVELLHTGERHVPFDLVRLG 66
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap