Conserved Protein Domain Family
alt_F1F0_F0_B

?
TIGR03321: alt_F1F0_F0_B 
alternate F1F0 ATPase, F0 subunit B
A small number of taxonomically diverse prokaryotic species, including Methanosarcina barkeri, have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, CC and in principle may run in either direction. This model represents the F0 subunit B of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132364
View PSSM: TIGR03321
Aligned: 8 rows
Threshold Bit Score: 313.141
Threshold Setting Gi: 78186931
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499894713   1 MPIDWFTVIAQGINFLLLLWLLKRFLYHPIIDGLDAREKKIAGILADADTCKSQAENLRTEYESKLAHIEQERTQLVGEA 80
gi 499627293   1 MLIDWFTVIAQVINFLILVWLLKRFLYKPILNAVDAREKRVADELKNADEKEAEAQKEKEKFKRKNEEFDQQRNDFLNKA 80
gi 499700242   1 MLIDGFTVVAQIVNFLILVWLLKRFFYRPILDALDERENRIASELAAATGKQREAEAELHRFRQKNEEFDQRREVLLTTV 80
gi 499782738   1 MLIDWFTVVAQALNFLILVWLLKRFLYQPILDAIDAREKRIALELADADTKRADAKRERDEFQQKNEVFDQQRAALLGKA 80
gi 499738276   1 MHIDWFVLLAQLVNFLILIYLLKRFLYTRIIQAMNEREAKIAARFDEAERLKREAEEAARVYEEKNSFLQGQEEKMLNQA 80
gi 499432705   1 MSIDWFTFTAQVINFLVLVGLLRYFLYAPIVRAMQAREQKVTQCLTDAETAKVEANQQRMSLEKQTQLLQERREELLTKA 80
gi 499662049   1 MLIDWFTVSAQAINFLILVALLKRFLYGPVLRAMDRREERLASCFAEAENKRLEAQQLEENYRSLLQELEEARGVKLRQV 80
gi 499677069   1 MLFDWFTFWAQLLNFLILVWLLKRFLYRPVLEAIDEREKKISGELRDADEGRKQAEQAIREWQEKMSRLDAQAAGMLETA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499894713  81 KNEAQMASQSLLDNARHNAEQIVKKRVAALRLEMAELKQDVLQQNIHEVYAISRKVLTELADGDLHTKMIDKLVQRLNTL 160
gi 499627293  81 KEEVQAERQRLFEDVREEASYLRAKQQEALRNEGQNLSQEIGRRTQQEVFFIARKVLTDLTETSLEERAVDVFVQRLRNL 160
gi 499700242  81 TDEVRAERQRLMEAAHADADRIRISRNEAQQREYQVLHDAIERRTCAEVLAITRKVLADLAGTTLEIHMTEAFIRRLRTL 160
gi 499782738  81 MEEAKTERQRLLDDARHAADALATKRQEALRSAQRSMSEALSHRARDEVFAIARKALGDLATTSLEERMGEVFTRRLREM 160
gi 499738276  81 REVVNHRQKEWMDSAREEVDAIRRRWIETVLQEKAAFLEHLRQRTGKQVFAIARKILDDLADTAIESKMVDVLIDRIHSL 160
gi 499432705  81 KADADNERQRLIAEARKEADTRREHWTSTFERDQKDLADQTRRDIQRMGFQAARETVQQLADEDLQKRVCQTFVKQLQTL 160
gi 499662049  81 EEEIEDQRHKLLAAARQEAAEIQSAWAASIRDERSSFFTELKKRVGSEMLNIARKSLGDLANIELEQLMVERFNERLAQL 160
gi 499677069  81 RKEAGEEKKRLQGEARREYDELRGRLRESLHEEQAALGRTIAGRIRAEVFRVSDSVLNSLADSGLQAQMARAFSGRLSEG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499894713 161 DDDQHAALTRALANSGNQ------------------------IVVRSAQPLAEAQKKQLLACLQQYLpsfkkdssqnnsv 216
gi 499627293 161 KDNEKKQLASALSTSPGQ------------------------VLIRTAFDLPQAQRDSIKKTIKETL------------- 203
gi 499700242 161 GPEEKAQLAVALQAGGVEsghsatfqvfppivgqgspsgiavILVRSAFELPAEQQEKISTVIRETL------------- 227
gi 499782738 161 DAKAKAALGEALKTASEP------------------------ALVRSAFELPADQRAAIQNAINETF------------- 203
gi 499738276 161 DPAEREKICSALEDSEEG------------------------AIVQSAFALFPEDRQRLTDTVRDLL------------- 203
gi 499432705 161 GEDQLAAIATQLADSGNP------------------------VLVRSAKGLDSSDQNQIRDAIHRVF------------- 203
gi 499662049 161 DRNEQQQVALAASERG--------------------------VLVRSPFTLPPELRDRLTQGVRQAL------------- 201
gi 499677069 161 GTE----VEELLKSGGTP------------------------LVLRSGFEMGEEEKELVRKTLADRF------------- 199
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 499894713 217 naapsnpA-PSIKLSESIVPRLINGIELTMGGWKLAWSTDNYLAELQEDVE 266
gi 499627293 204 -------G-IEIQPRFETAPDLVSGIELTTDGQKVAWSIADYLTSMQKSID 246
gi 499700242 228 -------K-EEVRFNFGVEPNLISGIEMIAGGHKVAWSVAGYLASLEEEVS 270
gi 499782738 204 -------S-ADIPLHFATAPEVVCGIELSTNGQKVGWSITDYLASLEKGVD 246
gi 499738276 204 -------GkPDAVIRYQESSDLIGGIEFLASGHRIAWSISDYLEHLEQDFD 247
gi 499432705 204 -------E-NKVEVRFESEPALIAGIEMDAGGYSLPWNAERTLKTMEANVA 246
gi 499662049 202 -------G-EEIDMQYQDRADMPLGIELTVGGLKLSWGVDSYFEQLERDVA 244
gi 499677069 200 -------G-YKGRLDFMTEESYRGGIALEQGGRSIEWSVNSRLEAIDEASS 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap