Conserved Protein Domain Family
alt_F1F0_F0_C

?
TIGR03322: alt_F1F0_F0_C 
alternate F1F0 ATPase, F0 subunit C
A small number of taxonomically diverse prokaryotic species, including Methanosarcina barkeri, have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F0 subunit C of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132365
View PSSM: TIGR03322
Aligned: 6 rows
Threshold Bit Score: 112.643
Threshold Setting Gi: 73670553
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499662048   2 DYLAWVAVASILSAGLCIGIGAIGPALGEGRALAQALAALAQQPDEANTITRTLFVGLAMVESTAIYCFVVSMILIFANP 81
gi 32398077   23 DSTTSIAVASIIMAGLTTAIGSIGPAFAEGRAVAQALNSIAQQPDSSNTITRTLFVGLAMIESTAIYCFVVSMILLFANP 102
gi 499738277   2 DSMTLIAMVSIVTAGLCMAVGSIGPALGEGNAVKQALTAIAQQPDERNSITRTLFVGLAMIESIAIYCFVISMILIFANP 81
gi 499782737   2 DSLTIIAVASIVIAGITTGFGCMGPALAEGRAVATALTALSQQPDASATITRTLFVGLAMIESTAIYCFVVSMILIFANP 81
gi 499677068   2 DILTIVAAVSIFTAGITIAVGSIGPALGEGRAVASALEALAQQPDASSSITRTLFVGLAMIESVAIYCFVTSMILIFANP 81
gi 499627294   5 TYITTIAVASIATAGITIGIGVIGPAIGEGRAVATALSSLAQQPDASATITRTLFVGLAMIESLAIYCFVVSMILIFANP 84

                 ....*.
gi 499662048  82 FWRFFL 87
gi 32398077  103 FWNQLT 108
gi 499738277  82 FWSHAI 87
gi 499782737  82 FWNHVI 87
gi 499677068  82 FWTMAL 87
gi 499627294  85 FWNRAL 90
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap