Conserved Protein Domain Family
alt_F1F0_F1_al

?
TIGR03324: alt_F1F0_F1_al 
alternate F1F0 ATPase, F1 subunit alpha
A small number of taxonomically diverse prokaryotic species, including Methanosarcina barkeri, have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F1 alpha subunit of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132367
View PSSM: TIGR03324
Aligned: 6 rows
Threshold Bit Score: 911.841
Threshold Setting Gi: 32398079
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499782739   7 LQKVFDKAFAGMREAREAFAPSLAPREVGTITSIATGIAKVSGLPGVGFDELVKFPGDLFGIAFNVDEAEIGVVLLGEYW 86
gi 499627292   6 LKDVFDKVFTEIHQARESVTPTLTPKEVGRILTVSTGIANVSGLPTVGFDELIKFPGDLFGIAFNVDEKEIGTVLLGEYS 85
gi 499894714   9 LKQGYQYLFEHLEQSRQRAQPNLVLQEIGSVKSVSAGIAIVHGLPSAGFEELLRFPGDIYGIAFNIDEHDIGVIMLGDYS 88
gi 499662050   8 ATQVLKEAFDTLDSALENFSPVLAVQHVGWVEYIGKGIARVGGLPGVRCEELLAFPGGLLGLALDADEDQVGVVLFGDYT 87
gi 499677070   6 LTESIDAALSSIGEASRTTQPEIELRENGVVTTVLNGIALIRGLPGVGYEELVEMSGGVYGIAFNVDPDEVGVVLLGEYA 85
gi 32398079   33 YSETLETAAQQFDQAVKSQPSQLTVTEIGTVEEVQRGIARVHGLPHVQVDEVLRFAGGHLGYAFNLDPDQVGCVLLDSSD 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499782739  87 HLHAGDEVDRTGRVMDVAVGDGLLGRVIDPLGRPLDGRGPVASSHRLPIERPASPIMDRAPVTVPLQTGLKVIDALIPVG 166
gi 499627292  86 HLHAGDQVERTQRVMDVAVGEELLGRVIDPLGRPLDNKGPIVSSKRLPIERPSPAIMDRAPVTVPLQTGVKVIDALIPIG 165
gi 499894714  89 QLNAGDEVKRTGRVVDIPVGADLIGRVIDPLGRTLDGKGNLTSTQRMAIERPAPEIMTRSPVTEPLQTGLKVLDALIPIG 168
gi 499662050  88 HLQAGDEVRRTGRVLDVPVGDGLIGRVVNPVGRCLDGGKPVAFQRQLPVERPAPPIMDRLPVTQPLMTGIKVIDALIPIG 167
gi 499677070  86 KLQAGGRARRTGRVMDVPVGDGLLGRVVNPLGRPLDAEGEPRFSGRLPIERPSPGIMDRNAVSTPLQTGLKVVDAIVPIG 165
gi 32398079  113 QITAGSRVERMHSVLDTPVGDQLLGRVVDPVGRPLDGGRSLDDLPREPCERDAPPIMQRAPVTVPLQSGLKVVDAMIPIG 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499782739 167 RGQRELILGDRQTGKTAIAIDTILNQQGQNVLCVYCAIGQRASAVAKVVATLREKGAMDFTTVVVTEGNDPPGLAYIAPY 246
gi 499627292 166 RGQRELILGDRQTGKTAIAIDTILNQRNFNVLCVYCAIGQRASAVARAVANLRERGAMDYTIVVVTEGNDPSGLIYIAPY 245
gi 499894714 169 KGQRELIMGDRQTGKTSIAIDAILNQKDKNVLCVYCAIGQKSASVAKILATLKHHNAFEYTVVMVTEGNDPPGLDYIAPY 248
gi 499662050 168 RGQRELILGDRQTGKTAIAIDAIINQRDQDVVCIYCAIGQRAASVAGVVTELRNCGALDYTIVVVAEGDAPPGLQYIAPY 247
gi 499677070 166 RGQRELILGDRQTGKTAIAVATILNQKGRNVICIYCAIGQRASAVAKVLAQLREHGAMAHTVAVVTEGNDPSGLQYIAPY 245
gi 32398079  193 RGQRQLLLGDRQTGKTAIAIDTIINQLGRDVICIYCSIGQRSTGVARVIENLRRHDALDHTIVVIGADDAPPGLQFLAPY 272
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499782739 247 AATSIAEHFMEAGRDVLIVYDDLTQHARAYRELSLLLRRPPGREAFPGDIFYIHSRLLERATHLRQERGGGSLTALPIIE 326
gi 499627292 246 AATSIAEYFMEAGRDVLIVYDDLTNHARAYRELSLLLRRPPGREAYPGDIFYIHSRLLERSTHLLKELGGGSLTALPIIE 325
gi 499894714 249 AATSIGEYFMEQGRDVLIVYDDLTQHARSYRELSLLLRRPPGREAFPGDIFYLHSRLLERSTHLNEAHGGGSMTALPIIE 328
gi 499662050 248 AATSMAEHFMEHGRDVLIVYDDLTRHARAYREISLLLRRPPGREAFPGDIFYVHSRLLERATHLNEPRGGGSLTALPIIE 327
gi 499677070 246 AATSIGEYFMEQGRDVLIVYDDLTNHARAYRELSLLLKRPPGREAFPGDIFYVHSRLLERSTHLRKELGGGSLTALPIIE 325
gi 32398079  273 AATTMGEHFMRQGRDVMIVYDDLTSHARAYRHLSLLLRRPPGREAFPGDIFYVHSRLLERSTHLIQSAGGGSLTALPIIE 352
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499782739 327 TQAQNISAYIPTNLISITDGQIYLSPSLFELGVLPAVDVGKSVSRVGGKAQRTAYRAVAGDLKLAYAQFEELETFARFGA 406
gi 499627292 326 TEAQNISAYIPTNLISITDGQIYLSPSLFELGVLPAVDVGKSVSRVGGKAQLAAYRAVAGDIKLAYSQFEELEAFTRFGA 405
gi 499894714 329 TEEQNMSAYIPTNLISITDGQIYLSPDLFSLGILPAVDVGKSVSRVGGKAQRSAFRKVSGALKLAYAQFEELETFARFGA 408
gi 499662050 328 TEAQNLSAYIPTNLISITDGQIYLSPELFQKGLLPSVDVGKSVSRVGGKTQLAAYRAVAGDLRLTYAQFEELEAFARFGT 407
gi 499677070 326 TEAQNISAYIPTNLISITDGQIYLSPTLFELGNLPAVDIGKSVSRVGGKAQLAAYRSVTGRLKLAYAQFEELENFARFGT 405
gi 32398079  353 TEAQNVSAYIPTNLISITDGQIYLSPTLFRKGVLPAIDVGRSVSRVGGKTQLPAYRVVAGDLRLTYSQFEELERFARFSS 432
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499782739 407 RLDENTTKIIEHGRRIRACLKQPESAPVSVAAQIAVLLALSAELFDGVELNQMTEAEQAVRAAAADMPAEVRARFDSADK 486
gi 499627292 406 RLDENTRKLIEHGRRIRALLKQPQNSPVPVPDQIVILVALNAKLFDNVPLDKMGEAESSLRKAVPDIPADVRDRFKGDKE 485
gi 499894714 409 RLDANSLQTIEHGQRIRSCLKQAESSPLSVAAQIVILLALTNDLFDAIDLAAMDSAQSAAIDGLTSLPLPIIEKLEQAES 488
gi 499662050 408 RLDEETRQVLHRGRRVRAILKQTQSSPRTAPQQVLVLHSLNSGVFDTVDEEALPAAEQAICAAVSEIP-EIVDKILQGKT 486
gi 499677070 406 RLDEASRKAITHGERIRECLKQDELDVLGVEEQILILLSLSEGQFDPLELSEVSGAMKRLSAAARELPRDLLERLHSDRP 485
gi 32398079  433 QLDEDTRATLDRGRLIREILKQTQFQPLTLPQQIASLIAVTNGVLDGVPVDQLPTIERAIQDAVTSQANDLCAQMQSGKK 512
                        490
                 ....*....|....*..
gi 499782739 487 LSDEDREAIIQIARVAL 503
gi 499627292 486 LSDKDRETILDIARKSL 502
gi 499894714 489 IEEQDQHIILDMLSQAL 505
gi 499662050 487 LSQEDLDVMHTVAKRVT 503
gi 499677070 486 LSDEDRRRLLQTAEAAL 502
gi 32398079  513 LDKQQVGQIANIAAGAV 529
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap