3FK4,2ZVI,2OEK


Conserved Protein Domain Family
salvage_mtnW

?
TIGR03332: salvage_mtnW 
Click on image for an interactive view with Cn3D
2,3-diketo-5-methylthiopentyl-1-phosphate enolase
Members of this family are the methionine salvage pathway enzyme 2,3-diketo-5-methylthiopentyl-1-phosphate enolase, a homolog of RuBisCO. This protein family seems restricted to Bacillus subtilis and close relatives, where two separate proteins carry the enolase and phosphatase activities that in other species occur in a single protein, MtnC (TIGR01691). [Amino acid biosynthesis, Aspartate family, Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 132375
View PSSM: TIGR03332
Aligned: 7 rows
Threshold Bit Score: 724.701
Threshold Setting Gi: 145580005
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3FK4_A         2 SGIIATYLIHDDsHNLEKKAEQIALGLTIGSWTHLPHLLQEQLKQHKGNVIHVEELAEHEHTNSYLRKKVKRGIIKIEYP 81
gi 445936345   2 SGIIATYLIHDDsHNLEKKAEQIALGLTIGSWTHLPHLLQEQLKQHKGNVLHVEELAEHEHTNSYLRKKVKRGIIKIEYP 81
gi 505196404  11 SELLATYLLTEPgADTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEEREGTAASE-------KQAVITIAYP 83
gi 496687068  11 SELLATYILADPgCDAEKRAEQIAIGLTVGSWTDLPLLKQEQLKKHKGRVVNVEE-TESELGE-------KQATVTIAYP 82
gi 499549671   2 SAVMATYLLHDE-TDIRKKAEGIALGLTIGTWTDLPALEQEQLRKHKGEVVAIEELGESERVNAYFGKRLKRAIVKIAYP 80
2ZVI_A        22 SELLATYLLTEPgADTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEEREGTAASE-------KQAVITIAYP 94
2OEK_A         2 SAVMATYLLHDE-TDIRKKAEGIALGLTIGTWTDLPALEQEQLRKHKGEVVAIEELGESERVNAYFGKRLKRAIVKIAYP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3FK4_A        82 LLNFSPDLPAILTTTFGKLSLDGEVKLIDLTFSDELKKHFPGPKFGIDGIRNLLQVHDRPLLMSIFKGMIGRNIGYLKTQ 161
gi 445936345  82 LLNFSPDLPAILTTTFGKLSLDGEVKLIDLTFSDELKKHFPGPKFGIDGIRNLLQVHDRPLLMSIFKGMIGRNIGYLKTQ 161
gi 505196404  84 EINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQ 163
gi 496687068  83 EANFTNDIPAVLTTVFGKLSLDGKIKLADLEFSRSFKQSLPGPKFGVYGIRKKIGEFERPLLMSIFKGVIGRDMEDLKEQ 162
gi 499549671  81 TVNFSADLPALLVTTFGKLSLDGEVRLLDLEFPDEWKRQFPGPRFGIDGIRDRVGVHNRPLLMSIFKGMIGRDLAYLTSE 160
2ZVI_A        95 EINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQ 174
2OEK_A        81 TVNFSADLPALLVTTFGKLSLDGEVRLLDLEFPDEWKRQFPGPRFGIDGIRDRVGVHNRPLLMSIFKGMIGRDLAYLTSE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3FK4_A       162 LRDQAIGGVDIVKDDEILFENALTPLTKRIVSGKEVLQSVYETYGHKTLYAVNLTGRTFDLKENAKRAVQAGADILLFNV 241
gi 445936345 162 LRDQAIGGVDIVKDDEILFENALTPLTNRIVSGKEVLQSVYETYGHKTLYAVNVTGRTFDLKENAKRAVQAGADILLFNV 241
gi 505196404 164 LRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNV 243
gi 496687068 163 LRQQALGGVDLIKDDEILFETGSAPFEKRITEGKKVLEEAFEETGRKTLYAVNLTGRTMELKAKARKAAELGADVLLLNV 242
gi 499549671 161 LKKQALGGVDLVKDDEILFDSELLPFEKRITEGKAALQEVYEQTGKRTLYAVNLTGKTFALKDKAKRAAELGADVLLFNV 240
2ZVI_A       175 LRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNV 254
2OEK_A       161 LKKQALGGVDLVXDDEILFDSELLPFEKRITEGKAALQEVYEQTGKRTLYAVNLTGKTFALKDKAKRAAELGADVLLFNV 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3FK4_A       242 FAYGLDVLQSLAEDDEIPVPIMAHPAVSGAYSASKLYGVSSPLLLGKLLRYAGADFSLFPSPYGSVALEKEEALAISKYL 321
gi 445936345 242 FAYGLDVLQSLAEDDEIPVPIMAHPAVSGAYSASKLYGISSPLLLGKLLRYAGADFSLFPSPYGSVALEKEEALAISKYL 321
gi 505196404 244 FAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEEC 323
gi 496687068 243 FAYGLDVLQSFAEDDDIPLPIMAHPAVSGALTSSPHYGFSHSLLLGKLNRYAGADFSLFPSPYGSVALPKRDALAIYDEC 322
gi 499549671 241 FAYGLDVLQALREDEEIAVPIMAHPAFSGAVTPSEFYGVAPSLWLGKLLRLAGADFVLFPSPYGSVALEREQALGIARAL 320
2ZVI_A       255 FAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEEC 334
2OEK_A       241 FAYGLDVLQALREDEEIAVPIMAHPAFSGAVTPSEFYGVAPSLWLGKLLRLAGADFVLFPSPYGSVALEREQALGIARAL 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3FK4_A       322 TEDDASFKKSFSVPSAGIHPGFVPFIVRDFGKDVVINAGGGIHGHPNGAQGGGKAFRTAIDATLQNKPLHEV--DDINLH 399
gi 445936345 322 TEDDVFFKKSFSVPSAGIHPGFVPFIIRDFGKDVVINAGGGIHGHPNGAQGGGKAFRTAIDATLQNKPLHEV--DDINLH 399
gi 505196404 324 VREDA-FNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKaeQCKDLK 402
gi 496687068 323 TKEDV-FKPTFAVPSAGIHPGMVPLLMKDFGIDHIINAGGGIHGHPNGAAGGGRAFRAVIDAVLEAEPVEEKakRSPDLK 401
gi 499549671 321 TDDQEPFARAFPVPSAGIHPGLVPLIIRDFGLDTIVNAGGGIHGHPDGAIGGGRAFRAAIDAVLAGRPLRAAaaENEALQ 400
2ZVI_A       335 VREDA-FNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKaeQCKDLK 413
2OEK_A       321 TDDQEPFARAFPVPSAGIHPGLVPLIIRDFGLDTIVNAGGGIHGHPDGAIGGGRAFRAAIDAVLAGRPLRAAaaENEALQ 400

                 ....*..
3FK4_A       400 SALQIWG 406
gi 445936345 400 SALQIWG 406
gi 505196404 403 LALDKWG 409
gi 496687068 402 LALEKWG 408
gi 499549671 401 KAIDRWG 407
2ZVI_A       414 LALDKWG 420
2OEK_A       401 KAIDRWG 407
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap