Conserved Protein Domain Family
F390_ftsA

?
TIGR03335: F390_ftsA 
coenzyme F390 synthetase
This enzyme, characterized in Methanobacterium thermoautotrophicum and found in several other methanogens, modifies coenzyme F420 by ligation of AMP (or GMP) from ATP (or GTP). On F420, it activates an aromatic hydroxyl group, which is unusual chemistry for an adenylyltransferase. This enzyme name has been attached to numbers of uncharacterized genes likely to instead act as phenylacetate CoA ligase, based on proximity to predicted indolepyruvate ferredoxin oxidoreductase (1.2.7.8) genes. The enzyme acts during transient exposure of the organism to oxygen. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132378
View PSSM: TIGR03335
Aligned: 3 rows
Threshold Bit Score: 918.118
Threshold Setting Gi: 88603472
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179597   8 YFNPEIETMERGELDALVEERIRYTVNYAYENSPFYSKWFRENNIKPSDIKSHEDLRELPIISGETVRKNQPPEKDRFEF 87
gi 499817998   5 YFNKDIETMERGELDSLVEDKLRYTIDYAVKHSPFYRKWFERNGVSPSSIQSHEDLLELPLVSGELIRKNQPPKTDDFQF 84
gi 499768455   6 FLRPDIETMKYPDLEALIDERIQYTVHYAAEHSPFYKKFFQEHNISPDDIKSHEDLLELPVISGQVIRENQPPVTSDFMF 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179597  88 KCAPWEEIYTIHETSGTSGRPKSFFLTWGDWQRYAEKYARSFVSQGFETGDRVVVCASYGMNVGANTMTLAAQKIGMTII 167
gi 499817998  85 MSADWTDIYTIHETSGTSGVPKSFFLTWHDWLRYAKKYGRSFCSQGFGPGDRMVMCASYGMNIGANTMTLAARDVGMAVI 164
gi 499768455  86 KSLDWKDIYTIHETSGTSGTPKSFFLSWDDWKRYAEKYARIFVSQGFTAEDRMIICASYGMNVGANTMTLAAREVGMSII 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179597 168 PEGKCTFPVRIMENYRPTGIVANVFKLLRLARRMKEQGIDPRESSIKRLVVGGESFAPESRAYVEELWGVDVYNTYGSTE 247
gi 499817998 165 PEGKCTFPTRIFETYRPTGIVASVFKLLRLARRLKNEGIDPKETSINKLIVGGESFADQSRSYLEEVWGCPVYNTYGSTE 244
gi 499768455 166 PTGKCTFPIRLIQSYQPTGIVGSVFKFLRLARRMKAEGMDPADSSIRRLVVGGESFADESRNYVKELYDCEVYNSYGSTE 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179597 248 GTMCGECHIKEGLHVPEDLVHLDVYDPNLRDFVDDGECGRIVLTTLLPVGERTGTLLLNYDTEDTTVVISRDTCRCGRTH 327
gi 499817998 245 GTMCGECVEQNGLHVPEDLVHLDVYDPYRKEFLEDGECGRIVLTTLLSPGEKCGSLLINYDTEDTTVVHSRDKCACGRTH 324
gi 499768455 246 GTMCGECQAVAGLHVPEDIVHLDIHDPRHQRFLPDGEEGHIVLTTLLKPGERCGSLLINYDTDDTTKVISRSRCPCGRTH 325
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499179597 328 MRIMNPEREAETFWISGHPFNRVDVEAAVFQRENMDYLTGEYEAFLYGDEdEGTVTMRVSLECEDPGNCAKEIIQENFIG 407
gi 499817998 325 MRIYAPEREAESLWVSGSPFNRVDVEQGVFQRENMDHLTGEYEAFLDKNS-VGKAVLKVNLECLDENNCDRDSIQENFLK 403
gi 499768455 326 MRILNPWREAETIQIFEVPINRIDIERAVFQPENLPSLTGEYEAFVYGEE-ENEITLRISVEAEDKDACSIHDITDVITG 404
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*.
gi 499179597 408 AFFKYKRDLHDAYLEGTFEIIFNFVGPGELEFYKVKGRPKRMVDRR 453
gi 499817998 404 GFLNPYTGTLNLYEEGGLDVDINFAGMGELEIFKLKGRPKRVVDRR 449
gi 499768455 405 TILKYKPELIGSYDDGIFQILVHITGPGGLELHHIRGRPKRLIDRR 450
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap