Conserved Protein Domain Family
phn_lysR

?
TIGR03339: phn_lysR 
aminoethylphosphonate catabolism associated LysR family transcriptional regulator
This group of sequences represents a number of related clades with numerous examples of members adjacent to operons for the degradation of 2-aminoethylphosphonate (AEP) in Pseudomonas, Ralstonia, Bordetella and Burkholderia species. These are transcriptional regulators of the LysR family which contain a helix-turn-helix (HTH) domain (pfam00126) and a periplasmic substrate-binding protein-like domain (pfam03466). [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 132382
View PSSM: TIGR03339
Aligned: 7 rows
Threshold Bit Score: 381.005
Threshold Setting Gi: 386059655
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 451753923  27 QLRAFDAVAREGSFTRAAERLCISQPAVTGHVKALEEHYQVTLFRRTARRIELTEEGSRLVAITRTLFALEEEAEALLDA 106
gi 499620892   5 QLKSFFMVARIGSVTQAAKRLGLSQPTITAQIRALEEAYGVELFHRGGRRLALSDAGLTLLPKVETLVQQETEIDFFLRH 84
gi 499233299   5 ELKSFHAVARCGTVTKAAAQLGVSQPTVTGQLRQLESRYGVELFHRQGRGLRLSDAGHRLMPLVEKLVQQESEIEFRLRD 84
gi 499655683   5 ELKAFYMVARLGSITLAAKKLGLSQPTVTTQIRNLESQYSVELFYRGGRRLSVSDEGARLLPMVKALLQQEADIEFFLRN 84
gi 499865768   4 QLKAFHATVRQGSITRAARHLGVSQPTIAAQIRQVEQVYGVELFYRSGRKLEVTETGIELLPLVEKMIALEAQADIMLRN 83
gi 499282759   5 QLRAFHNVAVCGGFSRAAEALFLTQPAVSDQVRKLEEEYDVLLFNRNKKQVTLTQAGHQLLEITRRMFDTEQQALDLLSE 84
gi 495226772   7 QLKAFHAVAVHGSFTKAAERLYLTQPAISDQVRKLEERFGVLLFHRNKRSVRLTDLGERLLAITQRLFVVEAEAQELLQE 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 451753923 107 NRQLVSGRLEVAADGPHLVMPMLARLRASYPGITVNLRLGNAQETLAALLSEHVDVAVLTEVEARPGLFLEELVNSRICA 186
gi 499620892  85 SGDLRTGSLRIGATAPYYVLDLIRRFSARYPAIDVTVEMGNSQEMLNALQEYRVDVAMSSNFVDDPRLSRLLLGVDPLVL 164
gi 499233299  85 ASDLREGCLRVGATGPFYIMDTVRRYNQRYPAIELSVAIGNSQSMLQALHDYRIDVATSSVAMNNPNLYRRAIAADPLRI 164
gi 499655683  85 SGQVQ-GALRIAATAPYYILDLVKTFRERLPQVEVSVEIGNSQQVLEALEDYRVDVAASSQLLDDARLIRRVLGSDPLVL 163
gi 499865768  84 VGGLFEGHLRIGATGPYYIMDAVGRFSSAHPSIALTCRIGNSEEILQALQEFRIDLAVSSQRNDADGLERKVISTDPLVL 163
gi 499282759  85 SRALRAGTLRIVADAAHHLLHILAAFRQKYPSVQISLRAGNTETVITSLYSYEADIGVLGEVPESREFDIVKLNSTPIIA 164
gi 495226772  87 SQALQTGSLILAVDAPVHVLPQIARFCERYPGISVKIETGNTDESLFRLFNYQADLALLGRDVSDERLLCVPLRNDPMVA 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 451753923 187 LLPRQHPWCERnEGVPLEELDQQIMVLREPGSITRRTFDRACAEQGVQPRVLLELDSREAVTEAVAAELGVGVVSSLEVG 266
gi 499620892 165 VVHRTHPLAGR-TEITPAALAGCRLLMREAGSTTRIATEQMLAEANVVPGSQMEIGSRESIREAVVRNLGVSVIALHEVP 243
gi 499233299 165 VVHRDHPLAAR-ASAGLADLAPYALLLREPGSMTRQLTEEALQKAGVAPARVLEIGSRESIRQAILCNLGVSLIPSREVP 243
gi 499655683 164 AVHRNHPLAAH-DHVTLSALAGHTLLMREPGSTTRRLTEELLASAGVSFGPLLEIGSRESIREAVLRNIGISIIARQEVP 242
gi 499865768 164 VVHRQHPLARF-ESIDAARLAGVRLLMREEGSVTRRCTETILAAAGVAATSVAEIGSREAIREAILHGVGGSLFPLGEAE 242
gi 499282759 165 FASTEHPIARR-STVSLEELSGQPLVMRERGSKTRQKLEDFAAAAGVALKPAIEAEGREAVREIVAAGAGVGFVSAAEFG 243
gi 495226772 167 FVSRHHPWAER-ESICLEDLDDTPLVLREHGSVTRQTLEEEMARAGFRIRPAIQVEGREAAREAVVVGIGVGVVSAAEFG 245
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 451753923 267 NDPRVRAVPLVGPELTNRHLIGCLEKRRGLRVIRAFLELA 306
gi 499620892 244 SHADLRVLHFTGGSPQLHEYMYCLRERRQARLIDAFVSLA 283
gi 499233299 244 AQAELATVAIADTEVLMHEYLYCLRERQPVQLIARFLELA 283
gi 499655683 243 HDPQLRVLTLENA-PQIPEYLYCLKERKNARLPAAFLGLA 281
gi 499865768 243 RHPDLRVIALRGVDTTIDEYVYYLKARRQSPAIDAFLACI 282
gi 499282759 244 RDGRLAPIEIVGAEMLMDEALICLKERSGGKLVRAFFEIA 283
gi 495226772 246 ADSRVCALPITDCTRRLTETLVCLREQSSRRVVATFLEMV 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap