Conserved Protein Domain Family
YhgI_GntY

?
TIGR03341: YhgI_GntY 
IscR-regulated protein YhgI
IscR (TIGR02010) is an iron-sulfur cluster-binding transcriptional regulator (see Genome Property GenProp0138). Members of this protein family include YhgI, whose expression is under control of IscR, and show sequence similarity to IscA, a known protein of iron-sulfur cluster biosynthesis. These two lines of evidence strongly suggest a role as an iron-sulfur cluster biosynthesis protein. An older study designated this protein GntY and suggested a role for it and for the product of an adjacent gene, based on complementation studies, in gluconate utilization. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 132384
View PSSM: TIGR03341
Aligned: 16 rows
Threshold Bit Score: 344.305
Threshold Setting Gi: 94676599
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499833778  62 ITITEAAQGYLADLLSKQDtD-GIGVRIFVEHPGTPRAECCMAYNQPGEEDSADLKFSYDNFSAFIEAASVPYLEDAVID 140
gi 499896184   2 ISISDTAQAHFCKLLEKQE-P-DTNIRVFVVNPGTPSAECGVSYCPPDAVESTDTTLEFNGFDAVVDAESAPFLSEAEID 79
gi 499552727   2 IRISEAAQSHFKKLLADQP-D-GTCIRVFVVNPGMANAECGVSYCPPDSVEPDDERLPFNGFDAVVDSGSAPFLEDAAID 79
gi 499352143   2 ITISENAQQHFIKLLSQQA-E-GTHIRVFVVNPGTAKAECGVSYCPPDAVEADDIQLPFEGFSAMVDADSKGFLEDAEID 79
gi 499648754   2 ISISETAQAHFAKLLADQA-Q-QTNIRVFVVNPGTSQAECGVSYCPEDAVEDSDIRLNFNGFDGVVDAESAPFLEDAEID 79
gi 489178527   4 ITITEAAQAYLAELLEKQStP-GIGIRIFITQPGTQYAETCIAYCKPGEEKVEDTAIALKDFTAWIDAVSEPFLEDAVVD 82
gi 499715679   2 VTVTESARDYLAQLLEKQKtE-GMGVRMFVTQPGTKYAETCLAYCKPEEIIKDDEKVEFDAFTLYLDKNSLPYLEEALVD 80
gi 499826452   5 IQITDNAQEYLAELLAKQNvE-GIAVRIFITQPGTPYAETCLAYCRPGEEEPSDERLDLDKITVYLEKNSIAFLEEAVVD 83
gi 499907739   7 IDITETAQDYLRDLLSKQD-QaEIGVRIFVERPGTPHAECCMAYCPEGEQEESDVRYDYEGFHAWIEGKSVRYLEDAVID 85
gi 491060054  17 LLITPSAQEYLGDLLEKQNtP-GIGVRIFVENPGTPRAECCMAYSAPDEVNPADYKQEYSDFPAYIDAPSIPYLLDAVID 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499833778 141 YNKDRFGGQLTFRAPNSKVPKVGADASVEERINYVLQSEINPSLAAHGGDVQLLELIDEEgvglTAVLKFGGGCQGCSAV 220
gi 499896184  80 FVTDQMGSQLTLKAPNAKARKVDDDAPLEERINYMIEAEINPQLASHGGKVMLMEITEKG----EAILQFGGGCNGCSMV 155
gi 499552727  80 FEEQEMGSQLTLKAPNAKARKVADDAPLIERVEYVIQAEINPQLASHGGQVMISEITDDG----VAILQFGGGCNGCSMI 155
gi 499352143  80 FTTDQMGSQLTLKAPNAKLRKVADDAPLFERVHYFLQAEVNPQLAGHGGECTLVEITDDG----YAVLQFGGGCNGCAQI 155
gi 499648754  80 FVTDKMGTQLTLKAPNAKARKISGDASLNERVQHMLETEVNPQLANHGGQVSLVEITAAG----IAVLQFGGGCNGCSMI 155
gi 489178527  83 YATDRMGGQLTIKAPNAKVPMVNEDSPITERINYYLQTEINPGLASHGGQVSLVDVVEDN----IAVLRFGGGCQGCGMV 158
gi 499715679  81 FNTERMGGQLTIKAPNAKMPKVDESSPLPDRINYILYTEINPGLASHGGEVSLVEVVDD-----VAVLKFGGGCQGCSAV 155
gi 499826452  84 FNADRMGGQLTIKAPNAKMPKVNADSPLEDRVNYVLYSEINPGLAAHGGEIRLMQLTEEN----VAVLQFGGGCQGCAAV 159
gi 499907739  86 YKKDSMGGQLTFRAPKSRVPDISEDATIEEKINYVLYAEINPNLAAHGGSVQLLELTDDN----VAVLEFGGGCQGCSVV 161
gi 491060054  96 YNKDRFGGQLTFRAPNSKVPRVGPDASIEERITYILQSEINPGLAGHGGNCALVEVQDDPenglTAVLKFGGGCQGCSAI 175
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 499833778 221 DMTLRQGVEVQLKQQIP-ELTQVIDETDHTRTENAYY 256
gi 499896184 156 DVTLKDGIEKQMLAQFSgELTAVKDATEHEAGEHSYY 192
gi 499552727 156 DVTLKNGIEKELLERFPeEVKGVRDITDHEPGEHSYY 192
gi 499352143 156 DVTVKDGIEKQLIELMAgEIKGVKDATEHERGDHSYY 192
gi 499648754 156 DVTLKEGIEKEMIEKFE-EITGVADITEHQAGDHSYY 191
gi 489178527 159 DMTLKDGVEKTLIERIP-ELKGVRDVTDHSNKENAYY 194
gi 499715679 156 DFTLKQGVEKTLLSKIP-ELKGVRDATDHTVTDNAYY 191
gi 499826452 160 DLTLKEGVEKTLIERVP-ELAGIRDVTDHTDDTNAYY 195
gi 499907739 162 DVTLRDGVEKTLQERIP-ELAGVRDKTDHTVTDNAYY 197
gi 491060054 176 DVTLKQGVETTLRQQIP-ELQRVVDQTDHTQAEGAYF 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap