Conserved Protein Domain Family
glycerol3P_GlpC

?
TIGR03379: glycerol3P_GlpC 
glycerol-3-phosphate dehydrogenase, anaerobic, C subunit
Members of this protein family are the membrane-anchoring, non-catalytic C subunit, product of the glpC gene, of a three-subunit, FAD-dependent, anaerobic glycerol-3-phosphate dehydrogenase. GlpC lasks classical hydrophobic transmembrane helices; Cole, et al suggest interaction with the membrane may involve amphipathic helices. GlcC has conserved Cys-containing motifs suggestive of iron-sulfur binding. This complex is found mostly in Escherichia coli and closely related species. [Energy metabolism, Anaerobic]
Statistics
?
PSSM-Id: 132422
View PSSM: TIGR03379
Aligned: 7 rows
Threshold Bit Score: 767.776
Threshold Setting Gi: 54308563
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 491963836  26 DESFESCIKCTACTAVCPVSRNNPLYPGPKQSGPDGERLRLKSAELYDEALKYCTNCKRCEVACPSDVKIGDLIVRARNN 105
gi 446923123   3 DTSFENCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCKRCEVACPSDVKIGDIIQRARAK 82
gi 500025575   7 NQTFDQCIKCTVCTAYCPVAKANPAYPGPKQAGPDGERLRIKSPELFDSALKYCTNCKRCEVACPSGVRIGDIIAKAKHQ 86
gi 499504877  26 DNSFESCIKCTVCTTYCPVAKVNPLYPGPKQAGPDGERLRLKDPALYDDALKYCTNCKRCEVACPSDVKIGDIIQRAKAS 105
gi 446937739  12 NTTFDQCIKCTVCTVYCPVAKANPNYPGPKQCGPDGERLRIKSAEYYDDALKLCTNCKRCETACPSGVKIGDMIAVARGK 91
gi 499927937  24 DESFESCIKCTACTVVCPVSRQNPFYPGPKQAGPDGERLRLKSAALYDEALKYCINCKRCEVACPSDVKIGDIIIRARNK 103
gi 499537322   7 DTSFDQCIKCTVCTVYCPVAKANPEFPGPKQCGPDGERLRIKSPEFYDELLKLCTNCKRCETACPSGVKIGDLIAVARDK 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 491963836 106 HlaQSKKPlmnKLRDAILSNTDVMGKINTPLAPIVNTITGLKATKFMLEKTLNISKKRTLPKYAFGTFRSWYMKNAlQDQ 185
gi 446923123  83 Y--DTTRP---SLRNFVLSHTDLMGSVSTPFAPIVNTATSLKPVRQLLDAALKIDHRRTLPKYSFGTFRRWYRSVA-AQQ 156
gi 500025575  87 Y--SGFKP---GIREFVLSHTDLMGSMSTLMAPVVNFTTGLKPMKLVLDKALGVSSHRDLPKYSQGTFRGWYKKQK-ASQ 160
gi 499504877 106 H--STNKP---KLRDAILSHTDIMGTLSTPFAPVINAVTGLKPVRVLLDKALKIDHRRELPKYSFGTFRRWYRKQA-EKQ 179
gi 446937739  92 Y--GKKPLnpkLVRDFVLSHTDLFGSIATPFAPLVNAATSLPLVKKLMHKTIGVHDHKTLPKYSHGTFRRWFKQNC-TSQ 168
gi 499927937 104 YldQQHKSpihKLRDAVLSNTDIMGKMNTPFAPIVNAITGLKATRYVLDKTLKVSKHRTLPKYSFGSFRQWYKKYAlDRQ 183
gi 499537322  87 H--AKKPFnikTIRDFVLSHTDLMGSVATPFAPIVNTITSIKPIKKIMHKTIGVHDHKSLPKYSHGTFRRWYKQNC-TSQ 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 491963836 186 QKFERKVAYFHGCYVNYNNPQLGKEFLKVFNAMNIGVMLLEKEKCCGLPLMVNGFPNRARNIAQFNTDYIGKMVDENGID 265
gi 446923123 157 AQYKDQVAFFHGCFVNYNHPQLGKDLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAITNVESIREAVGVKGIP 236
gi 500025575 161 ARFERQIAYFHGCYVNYNHPQLGKELVQVLNAMNIGVQLLEREKCCGVPLIANGFMDKAKQQAAFNIKQLENTLLGNEMP 240
gi 499504877 180 QQYTEQVAFFHGCFVNYNHPQLGKDLVSVFNAMNIGVQLLKREKCCGVPLIVNGFIEQAKKQARVNLESLTDTVIGRDIP 259
gi 446937739 169 PLYQRQVAYFHGCYVNYNHPQLGKDFVRVMNAMNIGVRLLDSEKCCGVPLIANGFHNKARKNALHNVKHLTAMVNDYHAP 248
gi 499927937 184 IYFRDKIVYYHGCYVNYNYPQLGKDLIKVLNSIDIGVILLEKEKCCGLPLMVNGFPEKAKKQAEFNIKQIERVIQEKALD 263
gi 499537322 164 ALYPQQVHYFHGCFVNYNHPQLGKDFVKIMNAMSIGVQLLDKEKCCGVPLIANGFFDKAKKNAKLNVRNFEAAIEKYDSS 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 491963836 266 VISEASSCSLNLRDEYHHILGIDNAKVRPHIHMVTPFLYQLFKEGKTLPLKPL------------KLRVAYHTACHVDKA 333
gi 446923123 237 VIATSSTCTFALRDEYPEVLNVDNKGLRDHIELATRWLWRKLDEGKTLPLKPL------------PLKVVYHTPCHMEKM 304
gi 500025575 241 LLATSSTCGFTLRDEYPHLLEQDNHKVRDRISLVTRFLWNEFYKGNKPAMKPL------------NLHIAYHTPCHMEKM 308
gi 499504877 260 VVATSSSCTFTLRDEYPHLLDVDTTPVRDKVELATRYLYRLLDQGRELPLKPLfslnpllasqeaPLRIAYHTPCHMEKM 339
gi 446937739 249 VLSTSSTCSFTLQQEYPHVLGVDNSQVVDQIHYVTRFLLKEFMSGNAPKMKPV------------HKKVVYHTPCHLERS 316
gi 499927937 264 IIGTSSSCTMNLRDEYHHILGMDNARIRPHVNIATKYLYRLYLDGKIPHFKST------------PLKVAYHTACHVEKA 331
gi 499537322 244 IISTSSTCSFTLREEYPHVLKVDNANVADKIEYVTRFLLKQFMNGNTPKMKPI------------NKKIVYHTPCHLERT 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 491963836 334 GWAPYTLEVLKKIPSLEIIMLPSQCCGIAGTYGFKSENYEISQSIGKNLFDNINEGGFDYVISECQTCKWQIDMSSNVTC 413
gi 446923123 305 GWTLYTLELLRNIPGLELTVLDSQCCGIAGTYGFKKENYPTSQAIGAPLFRQIEESGADLVVTDCETCKWQIEMSTSLRC 384
gi 500025575 309 GGVIYTLELLRAIPGVKVTVLDSQCCGIAGTYGFKSENYQTSQAIGEGLFDQINRLKPDLVITDCETCKWQIEMSTPFPC 388
gi 499504877 340 GWTAYTLALLQRIPGVELVVLDSQCCGIAGTYGFKSENYATSQGIGASLFQQIEDSGVDLVITDCETCKWQIEMSTSKKC 419
gi 446937739 317 GNVMFTIELLKMVPGLELVVLDSECCGLAGTYGFKEENYEVSKKIGSHLFDAIQTSDADYAVTDCETCKWQIEENAHLET 396
gi 499927937 332 GWAPYTLALLKQIPDLDVTILPSQCCGIAGTYGFKSENYQTSQAIGKSLFEVIEQGCFDYVITECETCKWQIDMSTSASC 411
gi 499537322 312 GGNLYTIELLKMIPGLEVVVLDSQCCGLAGTYGFKTENYDTSIAIGESLFKQIRQSNADFAITDCETCKWQIEENTQLET 391
                        410
                 ....*....|..
gi 491963836 414 IHPLTLLCMSMD 425
gi 446923123 385 EHPITLLAQALA 396
gi 500025575 389 EHPIHLLARALA 400
gi 499504877 420 EHPITLLARVLA 431
gi 446937739 397 IHPVSLLAMALI 408
gi 499927937 412 LHPVSLLARALN 423
gi 499537322 392 IHPISLLAMAIQ 403
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap