2EWO,3H7C


Conserved Protein Domain Family
agmatine_aguA

?
TIGR03380: agmatine_aguA 
Click on image for an interactive view with Cn3D
agmatine deiminase
Members of this family are agmatine deiminase (3.5.3.12), as characterized in Pseudomonas aeruginosa and plants. Related deiminases include the peptidyl-arginine deiminase (3.5.3.15) as found in Porphyromonas gingivalis. [Central intermediary metabolism, Polyamine biosynthesis]
Statistics
?
PSSM-Id: 132423
View PSSM: TIGR03380
Aligned: 19 rows
Threshold Bit Score: 655.531
Threshold Setting Gi: 238537983
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2EWO_A         8 TTPKQDGFRXPGEFEKQKQIWXLWPWRNDNWRLGAKPAQKAFLEVAEAISEFEPVSLCVPPLQYENALARVSElgshNIR 87
gi 73622156    6 SSSKKDGFRMPGEFEKHAGCYIIWPERPDNWRLGAKPAQKAFVDVATAISHFEPVTVVASSSQYVNARYMLSD----EIR 81
gi 73622163    6 TSPKKDGYRMPGEFEAHKDVYLLWPERPDNWREGAKPAQATFAKVAETIAQFESVTVGVSDRQYTNARHMLAD----NIQ 81
gi 73622157    6 GLPVEDGFRMPGEYEPHIGCFMIWPERPDNWRLGGKPAQQNYKEVAVAISNFEPVTMFVSPNQYKNARKELPD----TIR 81
gi 73622173   13 TKPSQDGFYMPAEWAAQQAVWMIWPYRPDNWRAAGAYAQATFAKVVDAIGAATPVYMGVPKAFLAKAKTVMPS----HVT 88
gi 73622181    9 GTPRQDGFFMPAEWAPQDAVWMLWPYRQDNWRGKAIPAQQTFAKVAEAISRATPVFMGVPAEFMAQAKATMPA----NVT 84
gi 73622179    5 TTPAQDGFYFPAEFQPVSEVWLAWPERKDNWRDDALPAQETFARIANLIAEVTKVCVAVCSHNFDRARQMLHS----DVR 80
gi 499825751  13 ATPAELGFSMPAEFAPHDACWMLWPQRPDNWRYGAKPAQAAFVAVARAIAESETVFVGVNDDQYENARNQLPS----RIR 88
gi 499693052   6 TTPKEDQYYLPAETKRHRESIMMWPERSDNWRNGAKPAQKTFAEIAAIINRYEPVTMLVSKEQYQNARHALPA----EIR 81
gi 499988059   5 QTPVQDGFRMPGEFEDQAESYLIWPERPDNWREGGKPAQKAFAQLAETIATYEPVTMLVNQGQYTHARTVLSP----AVR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2EWO_A        88 IIEXTNDDAWIRDCGPTFLVNDKGDLRAVDWEFNAWGGLVDGLYFPWDQDALVARKVCEIEGVDSYKTkDFVLEGGSIHV 167
gi 73622156   82 VVEMDNDDAWVRDSGPTFVVNDSGDVRGVDWSFNSWGGLVDGLYFPWDKDDQVAQKICELERKDRYRLaDFVLEGGSIHV 161
gi 73622163   82 VVEMSNNDSWIRDCGPTFVVNDKGDSRGVDWTFNAWGGLVDGLYFPWDKDDRVAQKVCEIEGRDRYRLdDLVLEGGSTHV 161
gi 73622157   82 VIEMSNDDAWIRDYGPSFLVNDKGEMRGVDWGFNAWGGLLDGLYFPWDKDNQIAKKVCDLERLDYYSQkDFILEGCSIHV 161
gi 73622173   89 LVEMDSNDCWARDTGPTVVVNAEGECRGVDWGFNAWGGHNGGLYFPWDKDEQVAQQMLAQHGFARYRA-PLILEGGSIHV 167
gi 73622181   85 LVEMASDDAWMRDTGPTMVINGAAERRAVDWQFNAWGGLNGGLYADWQQDEKVAVQVSDFLKNAHYSA-PLILEGGSIHT 163
gi 73622179   81 LVEIPFNDAWMRDIGPTVLVNQAGERRGISWQFNAWGGEYNGLYDNWQQDDLVAGSVCDIIGIDYYRA-PFVLEGGAIHT 159
gi 499825751  89 VIELSSNDAWMRDVGPTFLTHPDGRLAMVDWEFNAWGGLNGGLYFPWDKDRRIRQKIAEVLGIERFIT-PLVVEGGAIHV 167
gi 499693052  82 VIEMSYNDAWIKDIGPTYLLNQKNQIRAVDWRFNAWGGLVDGLYFPWDMDDQVAQKLCELTGIDYYHLeKFILEGCAFHT 161
gi 499988059  81 VVEMSSNDAWMKDVGPFYVVNDTGELRAVDFQFNAWGGLLDGLYFPWDQDNRIGKKVADLQRIPVYEA-QFVLEGCAIHV 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2EWO_A       168 DGEGTVLVTEXCLLHPSRNP-HLTKEDIEDKLKDYLNCVKVLWVKDGIDPYETNGHIDDVACFIRPGEVACIYTDDKEHP 246
gi 73622156  162 DGEGTLVTTEECLLSEGRNP-QLSKQQIEMVLKEYLNLEKIIWLKRGIYLDETNGHVDNIFNYVRPGVVALAWTDDETDP 240
gi 73622163  162 DGEGTLLVTEECLLSDGRNP-QLSKEQIESILKEYLNVEKIIWLKKGIYLDETNGHVDNIANFVKPGQVVLAWTDDQSDP 240
gi 73622157  162 DGEGTLVTTEECLLSEGRNP-NLTKIEIEQTLKKYFHVQKVIWLKHGFYLDETNGHVDNIFNFVAPGEVVLSWTDNKSDP 240
gi 73622173  168 DGEGTCMTSAECLLNANRNP-ELTKEQIEGLLRDYLNVKQFIWLQDGVYMDETDGHIDNMCCFARPGEVILHWTDDESDP 246
gi 73622181  164 DGEGTLLTTAECLLNPNRNP-HLNQAQIEQLLCDYLGVTHFIWLQDGVYNDETDGHIDNMCCFVRPGEVALHWTDDQQDP 242
gi 73622179  160 DGEGTLYTTEECLLSPGRNP-QLSKAQIEEQLKVYLGIEKIIWLPNGLFNDETDGHVDNLMHVIAPGKVVLSWTDDPSDP 238
gi 499825751 168 DGEGTLITTEECLLNPNRNP-DLAKPEIERLLCAYLGVEKIIWLPRGCFQDETDGHVDNLCCFVAPGEVALTWTDDDSDP 246
gi 499693052 162 DGEGTLIVTEESILSEGRNG-MLTKTEVEAVLKAYLGIEKVIWLKLGYFMDETNGDVDNMLSFVRPGELLLTWTDDQSDP 240
gi 499988059 160 DGQGTLIATEDVVLSEGRNPgGLTKAVAEQIFHDYLGITKTVWLPHGYFMDETNGDIDNLINFVAPGELVLTWTDDKHDP 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2EWO_A       247 FYQEAKAAYDFLSQQTDAKGRPLKVHKXCVTKePCYL--QEAATIDYVEGSIPREEGEXAIASYLNFLIVNGGIILPQYG 324
gi 73622156  241 QYEISKECFDILSNETDAKGRKLEVHKINVPK-PILItdEESKGVDAVEGTLPREEGDRLAASYINYYTANGGVIFPLFG 319
gi 73622163  241 QYAISKENYDMLINETDAKGRKLQVEKLYLPK-PILIteAESQGVDTVDGTLPRLAGDRLAASYVNYYTANGGIVFPLFN 319
gi 73622157  241 QYEISRECYDILANQTDAKGRTFMIHKLHCPD-PVLItqTESEGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFD 319
gi 73622173  247 QYPRSKAALEVLQNTVDAQGRKLKIHLLPQPG-PLYCseEESKGVTEGTG-VPRTAGERLAGSYVNFLITNHRIVFPLLD 324
gi 73622181  243 QYARSVAAFEVLSNTVDAKGRKLKIWKLPAPG-PLYNteEETFDVLTSDA-VPRTAGERLAGSYVNFLISNQQIIFPLLD 320
gi 73622179  239 QYALSRQAEQVLKSQHDAKGREIEIVRLPLPG-PLHYseREANGIDASSG-MSRQAGERLSASYANFLIVNGHVFLPMLD 316
gi 499825751 247 QHAISREALGILEAATDARGRRLTVHKLPMPG-PLTIaeTEASGVDRLSSSRPRQPGDRMAASYVNFYIGNSVVVMPRLD 325
gi 499693052 241 QYASSEEAYRILEAATDTKGRHFKIHKLQMPK-PMFAtqEESAGVDPINGLLPRYPGDRLTASYVNYYALNDAIILPIFD 319
gi 499988059 240 QYEISRQAYELLQQATDAQGRRFKIHKLQIPR-ILTLsdAEAQGVDPINGRLPRVAGQRLTASYVSYITTNRAILMPVFD 318
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....
2EWO_A       325 DENDQLAKQQVQEXFPDRKVVGVRTEEIAYGGGNIHCITQQQPA 368
gi 73622156  320 DPNDELAREKLQQLYPNCEVVGVKAREILLGGGNIHCITQQVPR 363
gi 73622163  320 DPMDEKAQEILQKLYPDRKIVGVPAREILLGGGNIHCITQQIPA 363
gi 73622157  320 DPKDKDAQELLEQLYPDRKIVGIKAREILLGGGNIHCITQHLPD 363
gi 73622173  325 PATDDIAAQKLQEIFPEHEIVGVPAREILLGGGNIHCITQQIPA 368
gi 73622181  321 SRTDGQANDLLQQMFPGYAIVGVPAREILLGGGNIHCITQQIPA 364
gi 73622179  317 EDTDAIAIDILQNAMPEYQIIAIPSREVLLGGGNIHCITQQIPA 360
gi 499825751 326 PAHDDEAHAILENLFPGRRVVAVDAREILLGGGNIHCITQQQPR 369
gi 499693052 320 DPQDTVAIQTLTQLFPDRKIEPVYARELLLGGGDVHCVVAAVPA 363
gi 499988059 319 DLQDAVAHRQLAALYPNRQVVDVSANEILTGGGNIHTIAAGVPG 362
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap