1ZWX,2DDR


Conserved Protein Domain Family
sphingomy

?
TIGR03395: sphingomy 
Click on image for an interactive view with Cn3D
sphingomyelin phosphodiesterase
Members of this family are bacterial proteins that act as sphingomyelin phosphodiesterase (EC 3.1.4.12), also called sphingomyelinase. Some members of this family have been shown to act as hemolysins. [Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 132436
View PSSM: TIGR03395
Aligned: 7 rows
Threshold Bit Score: 488.589
Threshold Setting Gi: 99032047
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZWX_A       11 FKITSHNVYLFSRNI--YPNWGQMHRADLIAQADYMKNNDVVILNEAFDTSASHRLLNNLREMYPHQTPVIGRSK-HGWD 87
gi 73921746 123 IKILSHSIFMAPTNLssWGDLGQEERAQRIASSSYIKNQDIIVFEGLSHNNAEKILLEKIRSEYPYQTNVVGRTK-KGWN 201
gi 26398005 155 IKVLSHNVFMLPTNLprWGNLGHDERAKRISKSDYVKNQDVIVFEEAFDTSARKILLDNLREEYPYQTDVVGRTK-KNWD 233
gi 130088    86 IKILTHNVFLLPKTLpgWGNWGQNERAQRIVSSNYIQNQDVIVFDEAFDTDARKILLDGVRSEYPYQTDVIGRTK-KGWD 164
gi 75471487  45 FKITSHNVYLFSRNI--YPNWGQMHRADLIAQADYMKNNDVVILNEAFDTSASHRLLNNLREMYPHQTPVIGRSK-HGWD 121
gi 130078    37 LKVMTHNVYMLSTNL--YPNWGQSQRADLIGAADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLGRSNgNEWD 114
2DDR_A       10 LKVMTHNVYMLSTNL--YPNWGQTERADLIGAADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLGRSSgSEWD 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZWX_A       88 KTEGNYSNFALEDGGVAVVSQWPIVEKSQHIFQ-RGGGADRLSNKGFAYVKIMKNGKPYHIIGTHTQADDSLISKDTsRA 166
gi 73921746 202 ATLGAYTTSPMANGGVIIVSKWPIEEKVQYIFNnSNCGQDQYYNKGFAYVKINKDGKKFHVIGTQLQAREPDCFNSG-ET 280
gi 26398005 234 ASLGNFRSYSLVNGGVVILSKWPIEEKIQYIFNdSGCGADWFANKGFVYVKINKEGKKFHVIGTHAQSQDQNCSNLG-IP 312
gi 130088   165 ATLGLYRTDAFTNGGVVIVSKWPIEEKIQHVFKeKGCGADVFSNKGFAYVRIDKNGRKFHIIGTHVQAQDSGCANLG-VV 243
gi 75471487 122 KTEGNYSNFALEDGGVAVVSQWPIVEKSQHIFQ-RGGGADRLSNKGFAYVKIMKNGKPYHIIGTHTPADDSLISKDTsRA 200
gi 130078   115 KTLGSYSSSTPEDGGVAIVSKWPIVEKIQYVFA-KGCGPDNLSNKGFVYTKIKKNDRFVHVIGTHLQAEDSMCGKTSpAS 193
2DDR_A       88 KTLGNYSSSTPEDGGVAIVSKWPIAEKIQYVFA-KGCGPDNLSNKGFVYTKIKKNDRFVHVIGTHLQAEDSMCGKTSpAS 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZWX_A      167 IRAEQMQEIQTFIAKKNIPKDEIIFIGGDLNVNY------GTDEYHDMLKLLNVSSPAnFNGQMATWDPTTNSMLKESYP 240
gi 73921746 281 IRKLQLNDIKSFIDSKDIPKDETVLITGDLNIIK------GSNEYFDMISKLNVNEPR-YVGVPFTLDTKTNALAAYYYE 353
gi 26398005 313 NRANQFDDIRNFIYSKNIPKDETVLIVGDLNVIK------ESNEYYDMISRLNVNEPR-YVGVPFTWDAKTNEIAAYYYE 385
gi 130088   244 SRVNQFNEIRDFIDSKKIPKNEMVLIAGDLNVIK------GSREYHQMLCILNVNNPK-YVGVPFTWDTKTNEIAAFYYK 316
gi 75471487 201 IRAEQMQEIQTFIAKKNIPKDEIIFIGGDLNVNy------GTDEYHDMFKLLNVSSPAnFNGQMATWDPTTNSMLKESYP 274
gi 130078   194 VRTNQLKEIQDFIKNKNIPNDEYVLFGGDMNVNKinaennSDSEYASMFKTLHASIPS-YTGHTATWDATTNSIAKYNFP 272
2DDR_A      167 VRTNQLKEIQDFIKNKNIPNNEYVLIGGDMNVNKinaennNDSEYASMFKTLNASVPS-YTGHTATWDATTNSIAKYNFP 245
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....
1ZWX_A      241 KAAPEYLDYIFVENGHARPHSWHNKVLHTKspqwS----VKSWFKT--YTYQDFSDHYPVVGFT 298
gi 73921746 354 KEKPIYLDYILVSKLHAQPPVWQNLAYDPI----S----NTTWKRSdgYTSYEFSDRYPVYGFI 409
gi 26398005 386 NEEPVYLDYIFVSKSHAQPPVWQNLAYDPV----S----KQTWTVSg-YTSDEFSDHYPIYGFV 440
gi 130088   317 KVEPAYLDYIFVSKSHFQPPIWQNLAYDPI----S----AKTWTAKg-YTSDEFSDHYPVYGFI 371
gi 75471487 275 KAAPEYLDYIFVENGHARPHSWHNKVLHTK----SpqwsVKSWFKT--YTYQDFSDHYPVVGFT 332
gi 130078   273 DSPAEYLDYIIASKDHANPSFIENKVLQPK----SpqwtVTSWLKK--YTYDDYSDHYPVAATI 330
2DDR_A      246 DSPAEYLDYIIASKDHANPSYIENKVLQPK----SpqwtVTSWFQK--YTYNDYSDHYPVEATI 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap