Conserved Protein Domain Family
nifS_epsilon

?
TIGR03403: nifS_epsilon 
cysteine desulfurase, NifS family, epsilon proteobacteria type
Members of this family are the NifS-like cysteine desulfurase of the epsilon division of the Proteobacteria, similar to the NifS protein of nitrogen-fixing bacteria. Like NifS, and unlike IscS, this protein is found as part of a system of just two proteins, a cysteine desulfurase and a scaffold, for iron-sulfur cluster biosynthesis. This protein is called NifS by Olsen, et al. (), so we use this designation.
Statistics
?
PSSM-Id: 132444
View PSSM: TIGR03403
Aligned: 5 rows
Threshold Bit Score: 757.849
Threshold Setting Gi: 57237300
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499452514   8 VYLDNNATTLVDPKVKELMDPYFCQMYGNPNSLHRFGTETHPAIKKALDDLYEGINAADEDDVIITSCATESNNWVIKGV 87
gi 499427942   4 VYLDNNATTMLDPSIKPLMEPYFCEKFGNPNSLHKYGTQTHAAISEAIEKLYKGINADDNDDIIITSCATESNNWVIKGV 83
gi 446864435   5 IYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGV 84
gi 499692888   3 VYLDNNATTMVDPLVVEEMMPFFSDIYGNPNSLHKFGTASHPAIAKAIDRVYKAVNARDSDDIVFTSCATESNNWVLKSI 82
gi 488956064   3 VYLDNNATTMLDPNAYELMLPFLKDIYGNPNSLHQYGSATHPALREALDKLYAGLGANDLDDIVITSCATESINWVLKGV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499452514  88 YFDILRHGVKNHIVTTDVEHPAVRATCAFLETLGVEVTYLPINDQGTISAEQVREAITEKTALVSVMWANNETGMIFPIQ 167
gi 499427942  84 YFDEIVKKGKRHIITTEVEHPAVRATCAFLETLGVEVTYLPINQQGTITAKQVRESLREDTALVSVMWANNETGLIFPIE 163
gi 446864435  85 YFDECLKKGKNHIVTTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVKEAITEKTALVSVMWANNETGLIFPIE 164
gi 499692888  83 YRDYIVNGDKNHIITTEVEHPSVYSACKALEEDGVKVTYLPVNSQGIVEAHVVKSFITDKTALVSIMWASNETGMINPIK 162
gi 488956064  83 YFDHILDRERNEVIISSVEHPAVAAAAYFLKSLGVKVIELPVNEEGVSTVEDLRKVISDKTALVSVMWANNETGMIFDIK 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499452514 168 EIGEICRERGILFHTDAVQAIGKIPVDVQKAKIDLLSFSAHKFHGPKGMGALYIRKGVELTPLFHGGEHMSGRRSGTLNV 247
gi 499427942 164 EIGTLCRQNNVLFHTDAVQAIGKIPVDVQSAQVDFLSFSAHKFHGPKGVGGLYIRKGIELTPLFHGGEHMRGRRSGTLNV 243
gi 446864435 165 EIGAICKEKGVLFHTDAVQAIGKIPVDVLKANADFLSFSAHKFHGPKGIGGLYIRSGVGLTPLFHGGEHMNGRRSGTLNV 244
gi 499692888 163 EIGEICKERGVLFHSDAVQAVGKIPVDLQDIHVDFLSMSAHKFHGPKGIGALYIKNSQPLSPLLNGGEHMGGRRSGTLNV 242
gi 488956064 163 AMAELAHEFGALFHTDATQAVGKIKVNLTQVGVDFASFSAHKFHGPKGVGGLFIKKGLKLTPLLHGGEHMGGRRSGTLNV 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499452514 248 AGIVGMGEAMRLAVQYLDFEKSNVRRLRDRLENALLELPDVFVVGSRENRVPNTVLISVKGVEGEAMLWDLNKAGIAAST 327
gi 499427942 244 PYIIAMGEAMKLANDYLDFELSQVKNLRDRLESALLEIPDVFVVGTRDNRVPNTTLISIRGIEGEAMLWDLNKAGIAAST 323
gi 446864435 245 PYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRIHRVPNTTLVSVRGIEGEAMLWDLNRSNIAAST 324
gi 499692888 243 PYIVAMGKAIELATENIEEKMASIRAKRDRLEDALLELSDTFVIGDREHRTPNTILISIKGVEGEGMLWDLNNGQIGAST 322
gi 488956064 243 PYIVAMGEALRIANTMLDFEDSHIRRLRDKLEDQILALPDTTVVGKREHRVPNTILASIKGVEGEAMLWDLNKNGIAAST 322
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 499452514 328 GSACASEDLEANPVMIAIGADKELAHTAIRLSLSRFTTEAEIDYTIEVFKKSAERLRSISSS 389
gi 499427942 324 GSACASEDLEANPVMVAIGADKELAHTAIRISLSRFTTSEEIDYTIEVFKKAVQRLRAISSS 385
gi 446864435 325 GSACASEDLEANPVMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAAVRLRNISSS 386
gi 499692888 323 GSACASEDLQANTVMLAIGADNELAHTGIRLSLSRFTTDSEIDYAITHFKKSVERLRAISSS 384
gi 488956064 323 GSACASEALESNPIMEAIGAEHDLAHTALRLSLSRFNTEEEIDYAAKQIKNATQRLRAISCT 384
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap