Conserved Protein Domain Family
urea_trans_UrtC

?
TIGR03408: urea_trans_UrtC 
urea ABC transporter, permease protein UrtC
Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 132449
View PSSM: TIGR03408
Aligned: 18 rows
Threshold Bit Score: 352.723
Threshold Setting Gi: 16119763
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499888956  29 PLALDTFRLNLFGKYLTYAFVAVGLVLCWGAGGILSLGQGVFFGLGGYCMAMFLKLEASTPENTaiqstpG---IPDFMD 105
gi 499800795  28 PLSLDLFRLNLVGKYLSYSFVALGLVMLWGYGGVLSLGQGVFFGLGGYGMAMFLKLEASDPVTTkiqstpG---IPDFMD 104
gi 499640306  27 PLVLSEFRLNLLGRFLSLAIVALGIDLIWGYTGLLSLGHGIFFGLGGYAIAMYLKLQIPEGE------------LPDFMG 94
gi 499198891  28 pfflSDFRTNLLGRYIAFAILVLGLDLLWGYTGVLSLGHGIFFGLGAYIMAMYLSLEGMTG---------A---VPDFML 95
gi 499684804  28 LFGFSQFRLNLFGRYFSLAFVALGIDLIWGYTGLLSLGQGIFFSLGGYAIAMHLLLVTKNDFTT------GangLPKFFE 101
gi 499903910  29 LGFVSNNTISLWGRYFCFAIAALGVDLIWGYSGVLSMCQAVFFCLGGYAIAMHMLLVAGGEDPS------G---IPDFMV 99
gi 499550638  19 PFYLTEFRLSLLGKFLCFAIVAVGISLIWGYTGILSLGHGVYFGLGAYCMAMYLKLEASQGH------------LPDFME 86
gi 499444127  27 pavvsvFGLNLLGRFLSLSIVALGIDLIWGFTGLLSLGQGIFFALGGYAAAMYLQLNSSSEQPN------G---IPEFFG 97
gi 489991303  26 PAVLSDFRLSLLGKFLCFAIVAVGIGLAWGRGGMLVLGQGVFFGLGGYMMGMHLKIADAEIRHQ------A---VPDFMQ 96
gi 499291372  32 PLALSDFRLGLLAKYLCTAMVAVGICLAWGRGGLLTLGQGVFFGLGGYAMAMHLKIVDAGPGT-----------IPDFMQ 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499888956 106 WNQ-LTALPWWWEPFNNLAFALFAVVAVPVIFAFIIGVAMFRRRVGGVYFAIITQAFAAILTILIIGQQGFTGGVNGI-T 183
gi 499800795 105 WNQ-ITALPLWWEPFRSFPLTLLLILVVPTFLAFIIGYAMFKRRVGGVYFAIITQAVALILTVLIIGQQGYTGGVNGM-T 182
gi 499640306  95 LYG-VTELPWFWRPFYSFPIAVATVVIVPGLLAGLLGYLVFRNRIKGVYFSILTQAAIIVFFNFFNGQQQFFNGTNGL-I 172
gi 499198891  96 WNG-ITGLPLLWQVFSNPFIAIIGAVTIPMLIASLLAFFTFRNRIKDVYFTILTQALVLVMVTLIVSQQSITGGTNGL-T 173
gi 499684804 102 NYG-VDQLPFFWEPFWSFPVSIAAIFIVPSIVAGLVGYLIFRNRIKGVYFSIITQASLMVFYHFFNGQQKLVNGTNGLkT 180
gi 499903910 100 WNQ-VDVLPAFWIPFHSFGLSFLLALLIPGIFAFIFGYFVFRSRIKGVYLAIITQALALAMWLIFLRNETMLGGTNGL-T 177
gi 499550638  87 WSG-VRELPWFWKPFAHPMVAIAAAIALPTLLAALLSYLTFKNRIKGVYFSLLSQAVVVVFVTLFIGKQEWTGGTNGL-T 164
gi 499444127  98 LYG-VDQLPGFWQPFHSPWFTLIAIWLIPALLAALLGNLVFRNRIKGVYFSILTQAALLVFFNFFNGQQKLINGTNGLkT 176
gi 489991303  97 IAG-VRELPGYWTPFASPVFTLLAILVIPAGIAALLGLGVFKRRVKGAYFAILSQALAAALAILLVG-QTSLGGSNGL-N 173
gi 499291372 101 LYGtATELPWWWRPFANPVFALAATVLLPMAVAAVLGSFIFRRRVKGAYFAILSQALAAAFAIWLVGQQATTGGTNGL-T 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499888956 184 DLRTLNGWDIRTDEAKELLYFVNGILLFACLFIAQFVRKSKLGRLLIAMRDQEDRVRFSGYDVASFKIFIFCLGAAFAGI 263
gi 499800795 183 DLKTILGWDTRTDSAKYILYFVTAGLLLGAIVLCTWIQKSKLGTLLLAMRDKEDRVRFSGYDVAMFRVFAFCFAAMLSAV 262
gi 499640306 173 DFTTLFGATVSDPKTKFIFYTLTVLFLAATYGICRWLTSGRFGRLLIAIRDDESRVRFSGYDPTDFKTLVFAVSGAIAGI 252
gi 499198891 174 GFSTIFGYSLSSASTQQVLYYLTLGCLILVFLLCAALVNSRFGRALVAIRDGENRLRFSGYDTSMFKVAIFTLSAGIAGL 253
gi 499684804 181 STTEIFGLQAGSDDAQLLFYRITLILLPFAFLLCKYLTSGRFGDALIGIRDDEPRLRFSGFNPTPFKVIVFVVAGGLAGV 260
gi 499903910 178 GFKTLLGFSLSSPSTKLGLYIVSFLVMFGLFLFCKWLVNSKFGKVLVAIRDSESRVSYTAYNVVNYKLAVFVIAAVVAAI 257
gi 499550638 165 NFSTVFGFSLSSPLTQIVLYWLTTACLALIFVAARRLTSGRLGKVLIAIRDAENRVRFLGFNPTVYKVFVYSLSAAFAGV 244
gi 499444127 177 DVTELFGQQVGSAFMQRGFFWLTAVMVILAWLAVRWVVRGRFGEVLIAIRDDEPRLRFAGYNPTLFKTIVFAMAGGLAGI 256
gi 489991303 174 NFRTFFGFTLNDPVNKRMLYFIAAATLLIVVAVVRQLMYSRYGELLVAVRDGEERVRFLGYDPANIKVVAYTLAALFASI 253
gi 499291372 180 DIQGFFGYDLDDPVNQRMVYFVIAAALLLLIALARQLIHSRYGELLVAVRDSEERVRFLGYNPANVKLVAYVVAAGMAGL 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499888956 264 GGAMFTLQVGFMSPTLVGIVPSIEMVIFCAVGGRLSIIGAVYGALLVNWAKTSLSETFPELWLLGLGGLFIAVVMLFPNG 343
gi 499800795 263 GGAMFTLQVGFMSPSLVGIVPSIEMVIFAAVGGRMSLVGAVYGALLVNFGKTYFSESFPDLWLFLMAAMFLGVVLAFPDG 342
gi 499640306 253 AGAFYTLQSGSVSPRAMDIAFSIEMVIWVAVGGRATLIGAVLGTLLVNYARAFLSEQFAEIWLFFQGALFLIVVTVLPDG 332
gi 499198891 254 AGMLYVLQVGMITPSMIGIIPSIEMILWVAIGGRGTLIGPVIGALVTNSAKTFFSESHPEAWLYLLGTVFVVIVLFLPGG 333
gi 499684804 261 SGALYTVQSGIVSPQFMSISMSIEMVIWVAVGGRGTLVGPILGAVIVNYLRSLVSEALPEAWLFVQGALFVFVVVLMPDG 340
gi 499903910 258 GGMLYVPQTGIITPGRMDVKASVEMVMWVALGGRGRLKGAIIGALLVNYLYSVCTSMFPESWLYILGVLFILTVLFFEKG 337
gi 499550638 245 AGALFVLQVGLISPEMMGIIPSIEMVLWAAVGGRQSLMGAIIGAIVMNTAKSFLSENYPDLWLLLLGALFVVVVLLVPKG 324
gi 499444127 257 GGALYTVQSGIVSPQYMTVPFSIDMVIWVAVGGRGTLIGAILGALVINLARSQISTVWPEGWLFILGGLFILVVTALPEG 336
gi 489991303 254 AGALFTPIVGFIAPSQVGIIPSIAFLIGVAIGGRTTLLGPVLGAIGVAWAQTLFSERFPSEWTYAQGLLFIVVVGFFPAG 333
gi 499291372 260 AGALFVPAVGIISPALIGIVPSIELVIGAAVGGRASLAGAVLGAIAVAWAKTALSEEFPAAWTYFQGLLFIVALAFLPGG 339

                 ....
gi 499888956 344 LAGV 347
gi 499800795 343 LAGV 346
gi 499640306 333 LVGW 336
gi 499198891 334 IMSL 337
gi 499684804 341 IYGW 344
gi 499903910 338 FWGL 341
gi 499550638 325 LAGI 328
gi 499444127 337 VVGW 340
gi 489991303 334 IAGL 337
gi 499291372 340 LASL 343
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap