Conserved Protein Domain Family
iscX_yfhJ

?
TIGR03412: iscX_yfhJ 
FeS assembly protein IscX
Members of this protein family are YfhJ, a protein of the ISC system for iron-sulfur cluster assembly. Other genes in the system include iscSUA, hscBA, and fdx. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 132453
View PSSM: TIGR03412
Aligned: 27 rows
Threshold Bit Score: 91.9638
Threshold Setting Gi: 53719893
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 488151264  2 KWTDTQRIAEELYDLHGETiDPRTVRFTQLRDLIMALPEFDDDPARCGERILEAVQQAWIDEAE 65
gi 499606970  2 KWTDINDIAIELCDAHPDK-DPLKINFVDLRDWVMALPGFNDDPKHCGEKILEAIQQAWIDEVA 64
gi 499447178  2 KWTDVNDIAIELADAHPDV-DPKTVRFVDLHNWVVELPGFDDDHARGGERVLEAIQQAWIDEAE 64
gi 556595793 15 KWVDVLEIAIQLAESKPEV-DPRYVNFVDLHRWVLALPEFSDDPSRGGEKVLEAIQAAWIDEAD 77
gi 499558651  2 KWTEVQEIAIQLSERHPET-DPAKVNFVDLMKWTMALPEFDDDPKHCGERVLEAIQQAWIDEVA 64
gi 499814006  4 RWIDSQEIALALIDKHPEV-DPTALHFPELMQWILALEDFDDDPKHCGEKVLEAVQMAWIDEAD 66
gi 499356297  6 lWSDSQEIALDLIEEHPNV-DPFKLHFTDLRQWVLDLERFDDDPKHCGERVLEAIQLAWMAEVD 68
gi 499384792  4 KWIDSLDIALELLEKHSEV-DPRKLHFTELYQWVLALEDFGDDPKHCNEKVLEAIQQCWIEEK- 65
gi 499536728  4 KWTDSRELAIELSEVYPDT-DPKLILFTDLRQWILDLEEFDDDPKHCSERVLEAVQMCWMEEED 66
gi 499310203  2 KWNDIQQIAEALYDQYPDV-DPTRLNFVDLHNKVVSLDGFDDDHKRGGEKFLEAIQQAWIDEAA 64
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap