Conserved Protein Domain Family
NifU_clost

?
TIGR03419: NifU_clost 
FeS cluster assembly scaffold protein NifU, Clostridium type
NifU and NifS form a pair of iron-sulfur (FeS) cluster biosynthesis proteins much simpler than the ISC and SUF systems. Members of this protein family are a distinct group of NifU-like proteins, found always to a NifS-like protein and restricted to species that lack a SUF system. Typically, NIF systems service a smaller number of FeS-containing proteins than do ISC or SUF. Members of this particular branch typically are found, almost half the time, near the mnmA gene, involved in the carboxymethylaminomethyl modification of U34 in some tRNAs (see GenProp0704). While other NifU proteins are associated with nitrogen fixation, this family is not. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 132460
View PSSM: TIGR03419
Aligned: 15 rows
Threshold Bit Score: 202.279
Threshold Setting Gi: 19703411
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499725856   3 YSDKVVDHYTNPRNTGVIKNPDGEGTVGNPVCGDIMTIYIKVDDDnKLSDVKFSTFGCGAAIATSSMITEMAIGMDVDEA 82
gi 499768443   2 YSEKVMDHFMNPRNQGEIPDADGVGEVGNPTCGDIMRIFLTVKDN-IITDVKFQTFGCGAAVASSSMATELIKGKTLEEA 80
gi 499626657   3 YSLKVMDHFSNPRNMGSIENSDGVGEVGNAKCGDIMKIYLKVEDN-RIADVKFQTFGCGAAIASSSMATEMIKGKTLEEA 81
gi 499332185   3 YSAKVLDHFSNPRNMGSIANCDGVGEVGNAKCGDIMKIFLKVEGD-RIVDVKFQTFGCGAAIASSSMATELIKGKILKEA 81
gi 586909884   5 YSEKVMDHFTNPRNVGEIENADGVGQVGNPVCGDIMRLYIKVEDG-IIKDVKFKTFGCGAAIATSSMVTEMVKGKTVEEA 83
gi 654585332   2 YSEKVMDHFTNPRNVGEIPDADGVGEVGNPSCGDIMRIYIKVDGD-KITDVKFKTFGCGAAIATSSMVTEMVKGKTIEEA 80
gi 544983076   3 YSDKVMEHFMNPRNMGEIDNASGVGEVGNPTCGDIMKIFLDIDGD-VIKDVKFKTFGCGSAIASSSMATEMIKGKTIKDA 81
gi 499660868   2 YSDKVIDHFTNPRNVGEIENADGVGEKVSSSCGDRMKVFLKVEND-IIEDVKFQTYGCGAAIASSSMMSELVIGKTLQQA 80
gi 499342524  15 YNKKVMDHFMNPRNVGEIENADGIGEAGNP-HGDQMKIFLKIRDN-RIEDVKFKTFGCAAAIASSSMATEMIKGKTLEEA 92
gi 499627392   2 YNKKVMDHFMNPRNVGEIEDANGVGEAGNP-HGDYMKIFLKIRDD-RVEDAKFKTFGCAAAIASSSMATELIKGKTLKEA 79
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 499725856  83 YHITRNDVADELDGLPPIKLHCSNLAADALQAAIENYREKKE 124
gi 499768443  81 WEVSNKAVAEALEGLPPIKMHCSVLAEEGIHKAINDYRIKNG 122
gi 499626657  82 WKLSNKAVAEALDGLPPIKMHCSMLAEEAIHEAINDYLKKKG 123
gi 499332185  82 WELSNKAVAEALDGLPPIKMHCSMLAEEAIHEAINDYLQKKG 123
gi 586909884  84 LKISNAAVAEALDGLPPQKMHCSNLAADALHKAIEDYQNRNk 125
gi 654585332  81 MKITNKAVADALDGLPPQKMHCSNLAADALKVAIEDYLKKKG 122
gi 544983076  82 LELTNKAVAEALDGLPPVKMHCSVLAEQAVKAALIDYAQKNN 123
gi 499660868  81 LDLTNDQVADALGGLPAPKLHCSNLAADALHEAIKNYQETNA 122
gi 499342524  93 WELTDEAVAEALEGLPPGKLECSVVSREATHRAINDYRKKQG 134
gi 499627392  80 WELTNEDVAEALEGLPPGKLECSVLSREAIHSAINEYRRKQG 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap