Conserved Protein Domain Family
urea_degr_1

?
TIGR03424: urea_degr_1 
urea carboxylase-associated protein 1
A number of bacteria degrade urea as a nitrogen source by the urea carboxylase/allophanate hydrolase pathway, which uses biotin and consumes ATP, rather than my means of the nickel-dependent enzyme urease. This model represents one of a pair of homologous, tandem uncharacterized genes found together with the urea carboxylase and allophanate hydrolase genes.
Statistics
?
PSSM-Id: 132465
View PSSM: TIGR03424
Aligned: 17 rows
Threshold Bit Score: 375.918
Threshold Setting Gi: 25027270
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499425423  15 HAVINEICDAGEPWVKEIKKGQIFRIVDLEGNQAVDTLFYNAHDAMERYSATDTVRRQHRLYLTTGSKLYSNFGNVMLVI 94
gi 499453497  13 RVVYDEVLAARRPWSHVVERGQVLRIVDLGGNQAVDFLVYNADDYSERYSAPDTIRLQGNIFLTTGSRLYSNDGGVLMTI 92
gi 499451533   6 NAIHQERVAAGIPWYRVVKKGEVIRIIDLLGCQAVDTLFYNAHNHEERYSAPDTIREQGSIFITKGTKLYSSEGNVMLEV 85
gi 499747242  15 NAVQDHFIPAEAPWSGVVRKGQTIRIEDSLGQQAIDTLFYRADDFSERYSNQDTMRMQGAAYIGIGTKIMSNEGNVMLTM 94
gi 500001924  12 DAVYSAIIPAGEPWMRVVHRGQYFRIVDLRGNQAVDTLFYNARDTADRYSAQDTIREQSNIYLTTGTRLISTRGTVLLTI 91
gi 499470329   9 RIVLDTEIPARVPWSAIIRKGQTLRIVDSHGQQAVDTLFYAADDHGERYSGQDTLRAQGSAYVTTGTRIMSTEGRTMLRM 88
gi 499222154  10 DIVHDEVVPARAPWLHAVKAGQTLRIVDLEGNQAVDFLVYSAADDAERYSAQDTIAAQKNIFLREGSVLLSNEGAAMMTV 89
gi 499908436  11 QAFFREEVAAGDYFIRIIKKGQTVRLLDLEGNQAADTLFYNAADPAERYSAVDTIREQGNVYLTAGTVLMSNRMNPLLKI 90
gi 489990504   8 QIIADETVAPRAPWSKIVRAGDVLTIVDLHGNQAVDTLFYGADDHGIRYSAPATIAAQGNIFLTTGTVLRDSDGAPMLTI 87
gi 500096951  15 KVVLDELVEARGPWSAVVAAGDILTIVDLDGNQAVDCILYAAHDTGTRYSAAATIAGQGSIFLTTGSILRADSGRELMTV 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499425423  95 TADTCGRHDTVGGACAAESNTTRYALDKYPMHSCRDSFLYALAHdpvcerL---GMSKRDVPANINFFMNVPVTEAGKLE 171
gi 499453497  93 VGDSVGRHDTSGGACSCESNSVRFGLDKKYQHACVENFLAALSR------Y---GMGKRDLVSNINFFMNVPVSRDGTLE 163
gi 499451533  86 LEDTCGNHDTLGGHCSAESNTVRFGHDKKYMHSCRDNYLFAIGE------L---EMNPRDLTNNINFFMNVPVEENGHLA 156
gi 499747242  95 TADSCGRHDTSAGACSCESNTVRFGHGTKYLHACRDNFVLEVSK------H---GMGKRDIVPNINFFMNVPIKPTGEMT 165
gi 500001924  92 VADTCGRHDTLGGACANESNMVRYAIEKRHMHACRSSFLKAVID------Wd-rGMEKRDIASNINFFMNVPVTPEGGLT 164
gi 499470329  89 VADSCGLHDTSAGACSCESNTVRFGHQTKYLHACRENFVLEAAK------H---GLSKRDIVPNLNFFMNVPLDPDGNFT 159
gi 499222154  90 TATAVAYHDTIGGACSCESNTLRYGHHTKAQHACVENFLVANAR------Q---GRGKRDMVSNVNWFMNVPVEADGALG 160
gi 499908436  91 VADTCGRHDTLGGACATESNTVRYSLEKRCMHACRDSWMLAINQ------HpefHLAKQDITHNINFFMNVPVTAEGGLT 164
gi 489990504  88 IDDEVGNHDTLGGACSQESNTLRYGHHTKHQHACVENFIGEGAR------W---GLTKADIVSNINFFMNVPVDPDGSLG 158
gi 500096951  95 VADEVGVHDTIGGACSQESNTLRYGQHTHEQHACVENFLIEGAK------W---ELGKKDLVSNINWFMNVPVDPDGALG 165
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*..
gi 499425423 172 FADGVSAPGKYVEMRAEMDVVVLISNCPQLNNPCNAYNPTPVRLLVW 218
gi 499453497 164 IVDGISEPGSTVDLRAEMNALVVISNCPQMNNPCNGYNPTPIRLVIW 210
gi 499451533 157 IVDGISKAGDYVEMEAKMDTLVLISNCPQLNNPCNGFNPTPIEILIW 203
gi 499747242 166 IVDGISAPGDYVELVAEMDVLCVISNCPQINNPCNGFDPTPIRVLIW 212
gi 500001924 165 FEDGISEPGKYVEMRAETEVLAMISNCPQLNNPCNAYDPTPVQVLIW 211
gi 499470329 160 VVDGVSKPGDYVEMVAEMDVLCLISNCPQVNNPCNGFFPTPIQVVIY 206
gi 499222154 161 IVDGISAPGLFVDLRAEMDVVVVVSNCPQINNPCNGFNPTPVRMIIa 207
gi 499908436 165 FEDGISAPGKYVELTACMDTLILISNCPQLNNPCNGYNPTPIDVLIW 211
gi 489990504 159 IVDGLSAPGKKLSLRAEIDTLVLISNCPQINNPCNGFDPTAVRMVVT 205
gi 500096951 166 IVDGLSAPGKRVALRAEVDTLVLVSNCPQINNPCNGFNPTPVRMIVT 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap