Conserved Protein Domain Family
TIGR03442

?
TIGR03442: TIGR03442 
ergothioneine biosynthesis protein EgtC
Members of this strictly bacterial protein family show similarity to class II glutamine amidotransferases (see pfam00310). They are distinguished by appearing in a genome context with, and usually adjacent to or between, members of families TIGR03438 (an uncharacterized methyltransferase) and TIGR03440 (an uncharacterized protein). [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 132483
View PSSM: TIGR03442
Aligned: 9 rows
Threshold Bit Score: 317.052
Threshold Setting Gi: 111022667
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499456851   1 MCRLLAYQGAPVALADLIEKPEHSLCVQSYQPKEMTSG-LLNADGFGFGWYDPARDSRPFRFRSTQPIWADANLGS-LGR 78
gi 499640224   1 MCRLLAYLGSPVSLEYLLYKPEHSLIVQSYQPREMTSG-VVNADGFGVGWYHSQKDTEPFTYKNTLPIWNDINLPS-LSR 78
gi 499931117   1 MCRLLGYLGEPILLESILTQPKHSLIVQSYQPQEMQES-LLNADGFGLGWYDTQKQTSPFTYKNTQPIWNDINLKS-LGG 78
gi 499369663   1 MCRLYAYMGRKTSLAHALVDAPHSLLVQSYQPREMTAG-LLNADGFGVGWYAARQDVLPFLYRQTIPMWQDINFTEhLSR 79
gi 499758133   1 MCRHLAWIGTPRTLAGLTLERPYSLLRQSWSPRRMRHG-TVNADGFGVGWYAPALRAAPARFRRAVPMWTDASYAS-IAG 78
gi 500042816   1 MCRHLGWLGADATVSSLMLEPPFGLRVQSYAPRRQKHG-LLNADGWGAGFFDGE---VPRRWRSPAPLWGDVSFES-VAP 75
gi 500051240   1 MCRHVAWLGAPRSLADLVLDPPQGLLVQSYAPRRQKHG-LMNADGWGAGFFDDE--GVARRWRSDKPLWGDASFAS-VAP 76
gi 511095062   1 MCRHLAYAGPAEPLGDLIMAPPHGLYRQSWAPRHQRYG-TVNADGFGVGWYADG-DPVPARYRRAGPIWADQSFAD-LAR 77
gi 499917094   1 MCRHLGYLGPEQSVGDLLSRGENSLLRQSYAPRDMRGGgTVNADGFGVGWWGSG---GFSRYRSAQPLWSDPVVRE-TLP 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499456851  79 YVHSSCVLANVRSATPGLAVDLSNCQPFAFERILGLHNGFIQNFRQTLYRPIRDSLDDPFYKAIDGSTDSEHVFAFVLNT 158
gi 499640224  79 YVESKCILAYVRSATAGQALDFANCQPFHYKQSLFIHNGYIENFRKTLHRKLRSTLTPDFYEHINGSTDSEHIFALLLSQ 158
gi 499931117  79 YIESGCILGYVRSATLGQGIDISNCQPFNYKNILFIHNGYIDQFRSTLYKPIRDSLQDIPYLLINGNTDSEHIFALLINE 158
gi 499369663  80 YIESACFLANVRSATPGQAVQMTNTQPFRWGRWLGMHNGFIDNFRQTLYRPMRDRLSDICYNIVEGSTDSEHLFALFCNE 159
gi 499758133  79 AVASGCVLAAVRSATVGMPIEESATAPFTDGHRLLSHNGRVD--PVAVRRMLRDRPDAP---VPDSTCDSALLAALVWEH 153
gi 500042816  76 ALHSHCVVAAVRSATAGMPIEISATAPFTDGRWLLSHNGVVD--RSVL--PVTSR--------AESVCDSAILAAVIFER 143
gi 500051240  77 ALRSRCVLAAVRSATIGMPIEPSASAPFSDGQWLLSHNGLVD--RGVL--PLTG--------AAESTVDSAIVAALIFSR 144
gi 511095062  78 VVRTGALLAAVRDATLAGADAEAAAAPFAAGAWLFSHNGAVAGWPGSL-APVAATLPPGELLSLEARNDSALVWALVLAR 156
gi 499917094  77 NIRSRAVVAAARSATVGMPVQHTACAPFSDETWAFSHNGVVRGWPESL-GALAAELPVNDLLQLEAPTDSAALWLLLRRA 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499456851 159 WERQG---GTLEDALTESIRTLAVWAAKEsvSVS--LNLIFADGERLVASRYANrpeapTLYWLADdptfP-EATIIASE 232
gi 499640224 159 IQSNKh--RSVESVLRNTLLMLWEMAKRH--QVNasANVVFSDGHRLIASRFASsssppSLYWLKDdltfP-NSVIIASE 233
gi 499931117 159 VLEIIk--YNFQEALHNILMFLKKIAQEN--KVKflANTIITDGHQLVASRFAQeasspSLYWLKNsskfP-NSVIIASE 233
gi 499369663 160 LVLNPq--LSPVMVLRQTLQIVFSLAQAA--RTRvsVAMILTDGLYILATRCSRgtpppTLYWSQD----A-EKIQLTSE 230
gi 499758133 154 AGk-----RPLAEAVAEVVLSLDAAGSGE--RAR--LNLLVVDGTQIVATAWRD-----SLSYRRE----K-DGVLVASE 214
gi 500042816 144 GL------DALGEVIAEI------GAADP--AAR--LNILAANGSRLLATAWGD-----TLSILRR----A-DGVVVASE 197
gi 500051240 145 GL------DALGATIAEV------GELDP--NAR--LNILAANGSRLLATTWGD-----TLSVLHR----P-DGVVLASE 198
gi 511095062 157 LRAGDdegRALTETVLEV------AAAAP--ASR--LNLLLTNGSTVTATTWGD-----TLWYLSR----PgGGTVVASE 217
gi 499917094 156 LGEQDp-eKAMSALVQDVV------AAAP--NSR--LNLLLGNGSELWATTWHH-----SLSALVD----D-ERAIVMSE 214
                        250       260       270
                 ....*....|....*....|....*....|
gi 499456851 233 PLFASrGWQCVPPGSVLTVDAEsKISVQPI 262
gi 499640224 234 PLFAG-NWTACPENSIISVGEDcDIKIESI 262
gi 499931117 234 PLFAD-DWQKFPEQSITKVSENlDIQIYQI 262
gi 499369663 231 PIDSEtEWYPLPENKLLLMSLQsEPEIYAF 260
gi 499758133 215 PDDDEpGWVDVPDHHLLVADTH-QVTLRNM 243
gi 500042816 198 PYDDDsDWEDVPDRHLVDVTAD-GVTLTPL 226
gi 500051240 199 PYDDDpGWSDIPDRHLVDVRDA-HVVVTPL 227
gi 511095062 218 PYDDDpHWREVPDRTLLTASRT-DVRLTPL 246
gi 499917094 215 PYDDNpAWQSIPDRHFVSARPG-HLIVTPL 243
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap