Conserved Protein Domain Family
mycothiol_Mca

?
TIGR03446: mycothiol_Mca 
mycothiol conjugate amidase Mca
Mycobacterium tuberculosis, Corynebacterium glutamicum, and related species use the thiol mycothiol in place of glutathione. This enzyme, homologous to the (dispensible) MshB enzyme of mycothiol biosynthesis, is described as an amidase that acts on conjugates to mycothiol. It is a detoxification enzyme. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 132487
View PSSM: TIGR03446
Aligned: 10 rows
Threshold Bit Score: 463.823
Threshold Setting Gi: 116669730
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500010312  11 LRLLAVHAHPDDESSKGAATMAMYAAAGVDVMVATCTDGSRGDIQNPAMEHePH-PKR--DMAGARRLEMDNAAKVLGIR 87
gi 589064843   8 FRLMAVHAHPDDESSKGAATTARYAAEGNEVKVVTLTGGERGDILNPAMDV-PG-VRD--RIHEVRIEEMAEAARILGVQ 83
gi 499584881   7 LRLMAIHAHPDDESSKGAATMARYAAEGNQVMVVTCTGGERGDILNPAMDK-PG-ILD--NIFAVRQEEMAKAMEILGTE 82
gi 489993605   4 LRLMAVHAHPDDESSKGAATTARYAAEGARVMVVTLTGGERGDILNPAMDL-PE-VHG--RIAEVRRDEMAKAAEILGVE 79
gi 662060084   4 LRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNPAMDL-PD-VHG--RIAEIRRDEMTKAAEILGVE 79
gi 489947542   8 ARLLAIHAHPDDESSKGAATMAKYVAEGHEVMVVTCTGGELGDVLNPSLDK-TA-VEG--RIAEVRREEMAQAVKELGVQ 83
gi 490071834   5 LRLMAVHAHPDDESSKGAATMAKYVSEGVDVLVVTCTGGERGSILNPKLQG-DAyIEE--NIHEVRRKEMDEAREILGVG 81
gi 499593168  13 YRLLAIHAHPDDESSKGAATMARYVDEGHRVKVLTCTGGERGDILNPEMQE-LA-EQGigEMIEVRREEMAQAASILGVE 90
gi 499610162   5 LRLMAVHAHPDDESSKGAATMARYVNEGAEVLVVTLTGGERGSILNPAMDR-PE-IRE--NIAEVRRKEMEEARRILGVR 80
gi 499757543  13 LRLMAIHAHPDDESSKGAATMARYASEGADVLVVTCTGGEEGSILNPAMDQ-PG-VAA--RMAEIRRQEMEAARLILGVR 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500010312  88 QRWLGFVDSGLPEGDPLPPLPPGSFALQPLEVAAAPLVRLVRDFKPHVIVSYDENGGYPHPDHIMAHRVAVEAFEAAGDP 167
gi 589064843  84 HQWLGFVDSGLPEGDPKPPLPEGCFALVPLEESTEALVRVIREFRPHVMTTYDENGGYPHPDHIRCHEVSMAAYEAAADP 163
gi 499584881  83 HRWLGYEDSGLPQGDPLPPLPEGCFALEDSDKVTQDLVKILREFRPHVIITYDENGGYPHPDHLKVHEVSMLAWEKSGDA 162
gi 489993605  80 HHWLGFVDSGLPEGDPLPPLPDGCFALVPLEEPVKRLVRVIREFRPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAADH 159
gi 662060084  80 HTWLGFVDSGLPKGDLPPPLPDDCFARVPLEVSTEALVRVVREFRPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAGDF 159
gi 489947542  84 HRWLGYHDSGFPEGEPHPPVPPGSFALEDSDEVAAKIVEIIREFRPHVIVTYDENGGYPHPDHLKVHEVSMLAWDLAGDP 163
gi 490071834  82 QEWLGFVDSGLPEGDPLPPLPEGCFALEDVDKAAGELVRKIRSFRPQVITTYDENGGYPHPDHIMTHKITMVAFEGAADT 161
gi 499593168  91 HEWLGYVDSGLPEGDPKPPLPEGCFALEDTDEVTQNVVRVVREFRPHVIITYDEYGGYPHPDHIKVHAVSVRAWEAAGDP 170
gi 499610162  81 QVFVGFIDSGLPEGDPPPPLPEGCFALQPLEVAAEPVVRLVREFRPHVMITYDEQGGYPHPDHIMCHKVSVEAFEAAADP 160
gi 499757543  89 QEWLGFVDSGLPEGDPPPPVPDGRFATIALGEAARPLVRLIRQFRPQVITTYDESGGYPHPDHIMTHRVSVEAFEAAGDP 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500010312 168 ERYQGA--G-----EPWAPGKLYYDRAFSPDRFRALHFALEEAGLQSPYA--ERLAAWLEADAEghtpppPTHPTTTQIE 238
gi 589064843 164 ERFPDA--G-----EPWKVQKVYYSHGFIRKRLLQFQEEYDRRGEEFPMA--EWLKKWKTEQGD------LMARVTTQIT 228
gi 499584881 163 AYAPEL--G-----APWEPLKLYYTHGFIRQRMEMFHDLLIEQGKPSPYT--PMLERWKANEAD------VMARVTTQVP 227
gi 489993605 160 LLYPDA--G-----EPWAVQKLYYNHGFLRQRMQLLQEEFAKNGQEGPFA--KWLEHWDPDNDV------FANRVTTRVH 224
gi 662060084 160 CRFPDA--G-----EPWTVSKLYYVHGFLRERMQMLQDEFARHGQRGPFE--QWLAYWDPDHDF------LTSRVTTRVE 224
gi 489947542 164 DYRLDL--G-----QPWAPLKLYYTHGFIRQRMEMFHNLLVEQGKPSPYE--GILDRWLEHRAD------IMARVTTQVY 228
gi 490071834 162 EKYPESeyG-----TAYQPLKVYYNQGFNRPRTEALHHALLDRGLESPYE--DWLKRWSE-FER------KERTLTTHVP 227
gi 499593168 171 NYHPEL--G-----EPWEVKKLYYTHGFIRERFENLATAMYERGAQLPEQvlQHLEMWR-QLPD------IFSRVTTRVN 236
gi 499610162 161 ERYPGT--G-----EPWQTSKLYYHVSFPLERFEAIAKVLSDRGMENPYA--DWMKRL-EKRDT------RRWEITTRVE 224
gi 499757543 169 DRYPEV--GvdaglEPWQPLKLYYHLTFHKERVLALHEEMMARGLESPYA--ERLAEW-VDRAE------DTGRLTTQVE 237
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 500010312 239 CGDYFEARDDALRAHRTQVDPLGFFFAVSPDMQRRAWPWEDYSLIQSRVPVE-LPEKDLFAGL 300
gi 589064843 229 CGDYFPQRDDALRAHATQIDPNGSFFAVPLEIQQKIWPTEEFELAKTRVTTS-IPENDLFAGI 290
gi 499584881 228 CERFFDQRDDALRAHATQIDPAGAFFGTPVEVQRRLWPTEEFELAKTRVKTS-IPEDDLFAGI 289
gi 489993605 225 CAEYFHQRDDALRAHATQIDPKGDFFHAPIEWQQRLWPTEEFELARARVPVT-LPEDDLFKGV 286
gi 662060084 225 CSKYFSQRDDALRAHATQIDPNAEFFAAPLAWQERLWPTEEFELARSRIPAR-PPETELFAGI 286
gi 489947542 229 AADYFDRRDAALKAHATQIDPAGTFFATPIETQQQLWPTEEFELARTRVSTS-LPEDDLFEGI 290
gi 490071834 228 CADFFEIRDKALIAHATQIDPEGGWFRVPMEIQKEVWPTEEYELAKSLVETS-LPEDDLFAGI 289
gi 499593168 237 VADWFERRDDALRAHRTQIDPKGAFFLADMDLQKQVWPTEEFELAQSRVSSE-LPETELFAGL 298
gi 499610162 225 CGEYFEVRDRALLAHATQIDPNSFWFAVPNDIQREAWPTEDYHLARSFVDTE-LPEDDLFAGI 286
gi 499757543 238 CADWFETRDRALIAHATQVDPTGWWFRIPLEVQRDAWPTEDYQLARSLIEVGmLPEDDLFNGV 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap