3C8Z


Conserved Protein Domain Family
mycothiol_MshC

?
TIGR03447: mycothiol_MshC 
Click on image for an interactive view with Cn3D
cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase
Members of this protein family are MshC, l-cysteine:1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase, an enzyme that uses ATP to ligate a Cys residue to a mycothiol precursor molecule, in the second to last step in mycothiol biosynthesis. This enzyme shows considerable homology to Cys--tRNA ligases, and many instances are misannotated as such. Mycothiol is found in Mycobacterium tuberculosis, Corynebacterium glutamicum, Streptomyces coelicolor, and various other members of the Actinobacteria. Mycothiol is an analog to glutathione. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 132488
View PSSM: TIGR03447
Aligned: 13 rows
Threshold Bit Score: 703.022
Threshold Setting Gi: 116670715
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C8Z_A         4 QSWSAPAIPVVPGRGPALRLFDSADRQVRPVTP-GP-----TATMYVCGITPYDATHLGHAATYLTFDLVHRLWLDAGHT 77
gi 499913364   2 QSWSETAVPSVPGQGPPLRLFDTADRQVRPVTP-GR-----TATMYVCGITPYDATHLGHAATYLTFDLVNRIWRDAGHD 75
gi 500048910   2 QSWSAPAIPVVPGRGPALRLFDSADRQVRPVTP-GP-----TATMYVCGITPYDATHLGHAATYLTFDLVHRLWLDAGHT 75
gi 499323925   2 QSWPTPEVPALAGTPVPLELFDTADQEVRLVET-PPagsdtPVGMYVCGITPYDSTHLGHAATYLAFDLIYRILLDNDHD 80
gi 499237394   2 QSWPMPTIPSVPGKPAVLSLFDTSDQLIKPVEVdTP-----EVGVYVCGITPYDSTHLGHAATYLTFDLINRQLIDAGHR 76
gi 499592802   2 HSWPEPEVPQLPGEAPQLRLYDTADDVVKPVEI-PAg----EVGMYVCGITPYDSTHLGHAATYLTFDLIHRYLRAAGHG 76
gi 499522826   2 QSWSDTALPTVPGAGPPLRLYDTADRQVRPVAP-GA-----TATMYVCGITPYDATHLGHAATYLTFDLVNRVLRDGGHD 75
gi 493820116   2 HSWPTPDIPALDGTPVPLALYDTADQQVKPVEV-PPsgsgtPVGMYVCGITPYDSTHLGHAATYLAFDLIYRVLLDNDHQ 80
gi 491438516   2 HAWPDPSVPVVAGTPVPLKLFDTADQRVKEVDT-TPda-ngEVGMYVCGITPYDSTHLGHAATYLTFDLAQRQLLANGHK 79
gi 490074987   2 HAWPASEVPALPGQGRDLRIHDTATGGPVTLDP-GP-----VARIYVCGITPYDATHMGHAATYNAFDLVQRVWLDTKRQ 75
gi 499611522   4 RSWPAPTVVALPDHGGPLSVHDTVTGSRRTITP-GA-----TARMYVCGITPYDAAHLGHAFTYLTFDLVNRVWRDAGHT 77
gi 500098848   2 KSWTSRPVPELPGSMPQLRLYDTALGRVVDVER-QP-----EQSMYVCGITPYDATHMGHAASYVAFDLLNRAWRDAGVR 75
gi 500011296   2 KSWISRPVPQLPGRMPAVRIFDTAVGAYSTLDA-TG-----EQSLYVCGITPYDATHMGHAASYVAFDLLNRAWRDGGQR 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C8Z_A        78 VQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRVLPPHDYVAATDAIAEVVEMVEKLLASGAAYIV--- 154
gi 499913364  76 VHYVQNVTDVDDPLFERANRDGEDWVVLGMRETALFREDMEALRVLPPRDYIGAVESIGEVIEMVEKFVASGAAYVV--- 152
gi 500048910  76 VQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRVLPPHDYVAATDAIAEVVEMVEKLLASGAAYIV--- 152
gi 499323925  81 VHYVQNITDVDDPLFERAARDGVDWRDLGTSQINLFRSDMEALSIIPPKDYIGAIESIDEVIEMVKTLLDEGAAYIV--- 157
gi 499237394  77 VHFVQNITDVDEPLFERALRDGVDWRELGSSQIDLFRSDMENLSVIPPRHYVGAMESIPEVIAMVETMLANGTAYIV--- 153
gi 499592802  77 VHYVQNITDVDDPLFERAERDGVDWQDLGTSQIDLFRSDMEDLAVIPPRDYIGAMESIDEVIEMVAKLLEVGAAYQL--- 153
gi 499522826  76 VHYVQNVTDVDDPLFERAARDGVDWRELGSREIELFRTDMAALRVLPPREYVGAVESVEEVVEFVQKLLANGAAYVV--- 152
gi 493820116  81 VHYVQNITDVDDPLFERAERDGVDWRELGTSQIDLFRKDMETLAVIPPKDYIGAIESIDEVIEMVSTLLEEGAAYVV--- 157
gi 491438516  80 VHYAQNITDVDDPLFERAERDGVDWRELGTSQINLFRSDMEILSVIPPRDYIGAMESVDEVIAMVQQLLDAGAAYEL--- 156
gi 490074987  76 VHYVQNVTDVDDPLLERAVRDGVDWTALAEQETALFREDMTALRMLPPQHYIGAVEAIPGIVPLVERLRDAGAAYEL--- 152
gi 499611522  78 VDYVQNITDIDDPLLERAAATGQDWQELAAREIQVFREDMAALRILPPRAFLGVVESMDLIADFVARLRAQGVTYEV--- 154
gi 500098848  76 VSYVQNVTDIDDPLLERATATGVDWRELAQSQIDLFQTDMDALNVLAPNHYIGAVEAIPDIVPAIEQLIADGVAYRVags 155
gi 500011296  76 VAYVQNVTDVDDPLLERATATGVDWRDLAASQIELFQTDMAALNVLAPDHYVGAVESIPEIVPAIERLLHLGLAYRVtgt 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C8Z_A       155 EDAEYPDVYFRADATAQ----------FGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEPSWP-S-PF 222
gi 499913364 153 DDPEFPDVYFRANATEQ----------FGYESGYDRETMDKFFAERGGDPDRPGKEDPLDALVWRAVRPGEPSWP-S-PF 220
gi 500048910 153 EDAEYPDVYFRADATAQ----------FGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEPSWP-S-PF 220
gi 499323925 158 EDAEYPDVYASINATDK----------FGYESNYDAATMAEFFAERGGDPERPGKKNPMDALLWRAAREGEPSWE-S-PF 225
gi 499237394 154 ESDSYRDIYASITATTQ----------FGYESHYSRELMEQFFAERGGDPERVGKKDSLDALIWRAHRLGEPSWD-A-PF 221
gi 499592802 154 EGDEYPDIYADYTFLPQ----------FGYESRYDEQQMAEFFAERGGDPERPGKRHPMDALLWRAHREGEPKWD-S-PF 221
gi 499522826 153 DDPDFPDIYFRTDATEQ----------FGYESGYDRATMERLFAERGGDPDRPGKRDPLDALLWRAARPGEPSWP-A-PF 220
gi 493820116 158 DDPEYPDVYASINATEN----------FGYESNYDAATMAELFAERGGDPDRPGKRNPMDALLWRAAREGEPSWE-S-PF 225
gi 491438516 157 DQ---GDIYASIDATEQ----------FGYESNLDRATMEEYFAERGGDPDREGKRDPLDALIWRGHREGEPAWD-S-PF 221
gi 490074987 153 EG----DVYFSVEADPH----------FGGVSHLDAATMRLLSAERGGDPDRPGKKNPLDPMLWMAAREGEPSWD-GgTL 217
gi 499611522 155 DG----DIYFSAADAPG----------FGSLSQLDRTAMLELFAERGGDPGRAGKKDPLDWLLWRAERPGEPAWD-T-PL 218
gi 500098848 156 EGEPDGDVYYDVETAGKrsdat-dawtLGDVSGLGEKEMLELFAERGGDPTRAGKRHALDPLLWRVARDGEPSWPgS-TL 233
gi 500011296 156 PGEPDGDVYYDVEAASKhsaeakdawtLGSVSGLSETEMLELFAERGGDPGRRGKRQALDPLLWRVARDGEPSWAgG-EL 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C8Z_A       223 GRGRPGWHVECSAIALTRIGTGLDIQGGGSDLIFPHHEYSAAHAESVTGErRFARHYVHTGMIGWDGHKMSKSRGNLVLV 302
gi 499913364 221 GPGRPGWHIECSAIALNRIGSGFDVQGGGSDLIFPHHEYSAAHAESATGDrRFARHYVHTGMIGLDGEKMSKSRGNLVFV 300
gi 500048910 221 GRGRPGWHVECSAIALTRIGTGLDIQGGGSDLIFPHHEYSAAHAESVTGErRFARHYVHTGMIGWDGHKMSKSRGNLVLV 300
gi 499323925 226 GAGRPGWHIECSAIATNRLGHSFDIQGGGSDLIFPHHEFSAAHAEAAHGVeRMAKHYVHAGMISQDGVKMSKSLGNLEFV 305
gi 499237394 222 GAGRPGWHVECSAIATHHLGSHFAIQGGGSDLIFPHHEFSAAHAEATFGEsRMAGHYVHTGMIGLDGTKMSKSLGNLVFV 301
gi 499592802 222 GPGRPGWHIECSAIAVNRLGAPFAIQGGGSDLRFPHHEFSATHAEAAHGVdRMAHHYVHTGMIGLDGTKMSKSLGNLVFV 301
gi 499522826 221 GAGRPGWHIECSAIALNRLGPEFDIQGGGSDLIYPHHEYSAAHAESVVAGrRFARHYVHAGLIGLDGEKMSKSRGNLVLV 300
gi 493820116 226 GPGRPGWHIECSAIATNRLGHSFDIQGGGSDLMFPHHEFSAAHAEAAHGVeRMAKHYVHAGMISQDGVKMSKSLGNLEFV 305
gi 491438516 222 GPGRPGWHVECSAIATNRLGSHFAIQGGGSDLAFPHHEFSAAHAEAALKVeRMAGHYVHAGMIALDGVKMSKSLGNLVFV 301
gi 490074987 218 GRGRPGWHIECVAIALDHLGMGFDVQGGGSDLAFPHHEMGASHAQALTGEfPMAKAYVHAGMVGLDGEKMSKSKGNLVFV 297
gi 499611522 219 GRGRPGWHVECSAISVHELGMGFDLNGGGDDLIFPHHEMGAAEACCATGSrPQARHYLHVAMVGLDGEKMSKSRGNLVFV 298
gi 500098848 234 GDGRPGWHIECTVIAQKYLPAPFTVQGGGSDLVFPHHEMGAGHAYSLSGV-PLARHYSHAGMVGLDGEKMSKSKGNLVLV 312
gi 500011296 235 GSGRPGWHIECTVIAQKYLPAPFTVQGGGSDLIFPHHEMGAGHAYSLTGV-PLARHFAHAGMVGLDGEKMSKSKGNLVLV 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C8Z_A       303 SQLRAQGVDPSAIRLGLFSGHYREDRFWSNEVLDEANARLARWRSAT-A--LPEAPDATDVIARVRQYLADDLDTPKALA 379
gi 499913364 301 SKLRGEGVDPAAIRLGLLSGHYRQDRPWTEQLLADAHTRLQLWKDAA-A--LESAPSATDTIARLRQHLADDLDTPKALD 377
gi 500048910 301 SQLRAQGVDPSAIRLGLFSGHYREDRFWSNEVLDEANARLARWRSAT-A--LPEAPDATDVIARVRQYLADDLDTPKALA 377
gi 499323925 306 SRLTAAGHEPGAIRLGVFANHYRGNRDWNAESLATAEQRLATWREAArA--ATNREDAIAVVEQLRAHLSADLDTPGALA 383
gi 499237394 302 SRLTSEGYHPSDIRLGVFAGHYRDDRDWSTDLLTAAQERRQAWITAA-Dn-ARDVQQVQQTIQKIRHLLANDLNTPAVLA 379
gi 499592802 302 SRLTAAGHEPAAIRLGVYAGHYRQDRDWTNDVLAHAEHRLASWRAAL-AtgSTTLDEARELVATVRGHLANDLDTAAALE 380
gi 499522826 301 STLRKDGVDPAAIRLGLLDGHYRQDRMWTDAVLEAALARLARWRSAT-A--LSAGPAAHDTIARLRQHLADDLDSPKALA 377
gi 493820116 306 HRLTAAGHEPGAIRLGVYAHHYRGDRDWSDEILAAAEARLALWRSAI-Tv-ATDVQAAVDAVAQLRTHLSNDLDTPAALA 383
gi 491438516 302 HKLSEAGHDPSAIRLAVFAGHYREDRDFSDAILAEAEERLTRWREQL-Ag-EVSEAEATEVVDKLRAILADDLNTPEALS 379
gi 490074987 298 SQLRREGVDPAAIRLTLLAHHYRSDWEWTDQVLQDALARLDRWRAAV-S--RPDGPPAEALVEEIREALANDLDSPAALA 374
gi 499611522 299 SQLRKAGTDPMAIRLALLAHHYRTAWEWTDADLRTAEQRLERWRAAA-A--VENAPDARPLLARVRSALADDLDTATALA 375
gi 500098848 313 SKLRAAGEEPAAIRLAILAHHYRSDWSWTDAEFAEAKDRLKQWRAAL-D--HAPAGSAAALISAMRDELANDLNAPGAIA 389
gi 500011296 314 SKLRAAGEEPAAIRLAILAHHYRTDWSWTEAGFAQAKTRLAEWRDAL-T--MAPGESAATLIAEMRSELANDLNAPGALA 390
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*....
3C8Z_A       380 ALDGWCTDALSYGGHD--TE------------SPRLVATTVDALLGVDL 414
gi 499913364 378 ALDGWARRALDHGGSD--TN------------APSEFAAAVDALLGVRL 412
gi 500048910 378 ALDGWCTDALSYGGHD--TE------------SPRLVATTVDALLGVDL 412
gi 499323925 384 AVDNWAAGIDTTTDSKefTE------------VGNIVVAAIDALLGVQL 420
gi 499237394 380 EVDNWANLIPLNDSAR--TE------------AGRLMASGLDALLGVKI 414
gi 499592802 381 ALDDWAADTKTGAAGD--EA------------AASEIKTAIDALLGVRL 415
gi 499522826 378 AVDNWVTEALDYGGSD--SG------------APAAIAEAVDALLGVRL 412
gi 493820116 384 AVDAWAEAALKDTGNV--SDtadqfdtpeftpAGRILAAAVDALLGVRL 430
gi 491438516 380 LLDGAAGD------------------------CNQIIATALDGLLGVRI 404
gi 490074987 375 AVDRWAALQQESGGTD--IG------------APGVVSRAVDALLGVAL 409
gi 499611522 376 AVDEWADAALSGSGDD--PD------------APALMRTTVDTLLGVAL 410
gi 500098848 390 AVDHWAAEAIRSGSDK--SEq-----------DTALVTDAIDALLGVEL 425
gi 500011296 391 AVDRWAVAAKQQAGAG--SPm-----------DQALVSDAVNALLGVEL 426
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap